| UniProt ID | PHF13_HUMAN | |
|---|---|---|
| UniProt AC | Q86YI8 | |
| Protein Name | PHD finger protein 13 | |
| Gene Name | PHF13 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 300 | |
| Subcellular Localization | Nucleus . Nucleus, nucleoplasm . Predominantly bound to chromatin, but a minor proportion is also detected in the nucleoplasm. | |
| Protein Description | Modulates chromatin structure. Required for normal chromosome condensation during the early stages of mitosis. Required for normal chromosome separation during mitosis.. | |
| Protein Sequence | MDSDSCAAAFHPEEYSPSCKRRRTVEDFNKFCTFVLAYAGYIPYPKEELPLRSSPSPANSTAGTIDSDGWDAGFSDIASSVPLPVSDRCFSHLQPTLLQRAKPSNFLLDRKKTDKLKKKKKRKRRDSDAPGKEGYRGGLLKLEAADPYVETPTSPTLQDIPQAPSDPCSGWDSDTPSSGSCATVSPDQVKEIKTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDSKFDIRRSNRSRTGSRKLFLD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MDSDSCAAAF -----CCCHHHHHHC | 30.08 | 26074081 | |
| 5 | Phosphorylation | ---MDSDSCAAAFHP ---CCCHHHHHHCCH | 15.03 | 26074081 | |
| 15 | Phosphorylation | AAFHPEEYSPSCKRR HHCCHHHCCCCCCCC | 24.99 | 30108239 | |
| 16 | Phosphorylation | AFHPEEYSPSCKRRR HCCHHHCCCCCCCCC | 17.39 | 25849741 | |
| 18 | Phosphorylation | HPEEYSPSCKRRRTV CHHHCCCCCCCCCCH | 26.74 | 30108239 | |
| 20 | Ubiquitination | EEYSPSCKRRRTVED HHCCCCCCCCCCHHH | 53.96 | - | |
| 38 | Phosphorylation | FCTFVLAYAGYIPYP HHHHHHHHCCCCCCC | 9.08 | - | |
| 41 | Phosphorylation | FVLAYAGYIPYPKEE HHHHHCCCCCCCHHH | 7.20 | - | |
| 44 | Phosphorylation | AYAGYIPYPKEELPL HHCCCCCCCHHHCCC | 19.85 | - | |
| 53 | Phosphorylation | KEELPLRSSPSPANS HHHCCCCCCCCCCCC | 55.04 | 28348404 | |
| 54 | Phosphorylation | EELPLRSSPSPANST HHCCCCCCCCCCCCC | 23.98 | 28348404 | |
| 56 | Phosphorylation | LPLRSSPSPANSTAG CCCCCCCCCCCCCCC | 38.30 | 28348404 | |
| 113 | Phosphorylation | FLLDRKKTDKLKKKK CCCCHHHHHHHHHHH | 41.21 | - | |
| 127 | Phosphorylation | KKRKRRDSDAPGKEG HHHHCCCCCCCCCCC | 33.58 | 28985074 | |
| 183 | Phosphorylation | PSSGSCATVSPDQVK CCCCCCEECCHHHHH | 26.33 | - | |
| 185 | Phosphorylation | SGSCATVSPDQVKEI CCCCEECCHHHHHEE | 20.57 | - | |
| 294 | Phosphorylation | SNRSRTGSRKLFLD- CCCCCCCCCCCCCC- | 26.15 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PHF13_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHF13_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHF13_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TBX20_HUMAN | TBX20 | physical | 26186194 | |
| DNSL2_HUMAN | DNASE1L2 | physical | 26186194 | |
| PPIE_HUMAN | PPIE | physical | 26186194 | |
| TBX20_HUMAN | TBX20 | physical | 28514442 | |
| DNSL2_HUMAN | DNASE1L2 | physical | 28514442 | |
| PPIE_HUMAN | PPIE | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
