| UniProt ID | PRDC1_HUMAN | |
|---|---|---|
| UniProt AC | Q9NRG1 | |
| Protein Name | Phosphoribosyltransferase domain-containing protein 1 | |
| Gene Name | PRTFDC1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 225 | |
| Subcellular Localization | ||
| Protein Description | Has low, barely detectable phosphoribosyltransferase activity (in vitro). Binds GMP, IMP and alpha-D-5-phosphoribosyl 1-pyrophosphate (PRPP). Is not expected to contribute to purine metabolism or GMP salvage.. | |
| Protein Sequence | MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAGSSEEAP ------CCCCCCCCC | 26.95 | 22814378 | |
| 4 | Phosphorylation | ----MAGSSEEAPDY ----CCCCCCCCCCC | 25.66 | 26852163 | |
| 5 | Phosphorylation | ---MAGSSEEAPDYG ---CCCCCCCCCCCC | 38.24 | 26852163 | |
| 67 | Phosphorylation | IMKDIGYSDIMVLCV HHHHCCCCCCHHHHH | 18.56 | 20068231 | |
| 130 | Phosphorylation | IIGGDDLSTLAGKNV EECCCCHHHHCCCCE | 28.50 | - | |
| 160 | Phosphorylation | LLSNIEKYKPNMIKV HHHHHHHHCCCHHHH | 20.91 | - | |
| 173 | Ubiquitination | KVASLLVKRTSRSDG HHHHHHHHHCCCCCC | 50.34 | 21890473 | |
| 205 | Phosphorylation | YALDYNEYFRDLNHI EEECHHHHCCCCCCE | 10.56 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRDC1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRDC1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRDC1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NIF3L_HUMAN | NIF3L1 | physical | 16189514 | |
| FAD1_HUMAN | FLAD1 | physical | 16189514 | |
| EF2KT_HUMAN | EEF2KMT | physical | 16189514 | |
| RTN3_HUMAN | RTN3 | physical | 22939629 | |
| MCMBP_HUMAN | MCMBP | physical | 25416956 | |
| EF2KT_HUMAN | EEF2KMT | physical | 25416956 | |
| LEG9B_HUMAN | LGALS9B | physical | 25416956 | |
| TM14B_HUMAN | TMEM14B | physical | 21516116 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |