UniProt ID | ZDHC3_HUMAN | |
---|---|---|
UniProt AC | Q9NYG2 | |
Protein Name | Palmitoyltransferase ZDHHC3 {ECO:0000305} | |
Gene Name | ZDHHC3 {ECO:0000312|HGNC:HGNC:18470} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 299 | |
Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein . |
|
Protein Description | Palmitoyltransferase with broad specificity. [PubMed: 21926431] | |
Protein Sequence | MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | NIERKPEYLQPEKCV CCCCCCHHCCHHHCC | 21.11 | 28674419 | |
100 | Phosphorylation | SHCRAMLTDPGAVPK HHHHHHHCCCCCCCC | 27.36 | 24114839 | |
112 | Ubiquitination | VPKGNATKEFIESLQ CCCCCCCHHHHHHCC | 48.49 | - | |
121 | Acetylation | FIESLQLKPGQVVYK HHHHCCCCCCCEEEE | 33.85 | 19608861 | |
121 | Ubiquitination | FIESLQLKPGQVVYK HHHHCCCCCCCEEEE | 33.85 | - | |
127 | Phosphorylation | LKPGQVVYKCPKCCS CCCCCEEEECCCCCC | 14.17 | 22817900 | |
128 (in isoform 2) | Malonylation | - | 32.24 | 32601280 | |
128 | Acetylation | KPGQVVYKCPKCCSI CCCCEEEECCCCCCC | 32.24 | 25953088 | |
146 | S-palmitoylation | RAHHCSVCKRCIRKM CHHCCHHHHHHHHHC | 1.01 | - | |
231 | Phosphorylation | GLLFLIFTSVMFGTQ HHHHHHHHHHHHCCH | 39.55 | - | |
232 | Phosphorylation | LLFLIFTSVMFGTQV HHHHHHHHHHHCCHH | 34.06 | - | |
241 | Phosphorylation | MFGTQVHSICTDETG HHCCHHHHHCCCHHH | 16.01 | - | |
286 | Phosphorylation | GWASPFATPDQGKAD CCCCCCCCCCCCCCC | 40.77 | 25159151 | |
295 | Phosphorylation | DQGKADPYQYVV--- CCCCCCCCCCCC--- | 27.91 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZDHC3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZDHC3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZDHC3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ZDHC3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...