dbPTM

ANFB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ANFB_HUMAN
UniProt AC	P16860
Protein Name	Natriuretic peptides B
Gene Name	NPPB
Organism	Homo sapiens (Human).
Sequence Length	134
Subcellular Localization	Secreted.
Protein Description	Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3..
Protein Sequence	MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Phosphorylation	LGSPGSASDLETSGL CCCCCCHHHHHHCHH	44.41	-
62	O-linked_Glycosylation	SELQVEQTSLEPLQE HHHHHCCCCCCCCCC	23.05	16750161
63	O-linked_Glycosylation	ELQVEQTSLEPLQES HHHHCCCCCCCCCCC	30.35	16750161
70	O-linked_Glycosylation	SLEPLQESPRPTGVW CCCCCCCCCCCCCCE	17.16	16750161
74	O-linked_Glycosylation	LQESPRPTGVWKSRE CCCCCCCCCCEECHH	45.72	16750161
79	O-linked_Glycosylation	RPTGVWKSREVATEG CCCCCEECHHHHCCC	20.26	16750161
84	O-linked_Glycosylation	WKSREVATEGIRGHR EECHHHHCCCCCCCC	39.66	16750161
84	Phosphorylation	WKSREVATEGIRGHR EECHHHHCCCCCCCC	39.66	-
96	Phosphorylation	GHRKMVLYTLRAPRS CCCEEEEEEEECCCC	7.72	28258704
97	O-linked_Glycosylation	HRKMVLYTLRAPRSP CCEEEEEEEECCCCC	12.95	16750161
97	Phosphorylation	HRKMVLYTLRAPRSP CCEEEEEEEECCCCC	12.95	24719451
103	Phosphorylation	YTLRAPRSPKMVQGS EEEECCCCCCCCCCC	28.01	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ANFB_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
97	T	Glycosylation	16750161
Glycosylation at Thr-97 appears to inhibit FURIN- or CORIN-mediated proteolytic processing, at least in HEK293 cells.
97	T	Glycosylation	16750161
Glycosylation, especially at Thr-97, may also be important for brain natriuretic peptide 32 stability and/or extracellular distribution.
97	T	Glycosylation	16750161
In cardiomyocytes, glycosylation at Thr-97 is essential for the stability and processing of the extracellular natriuretic peptides B.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
62	O-linked Glycosylation	72 (10)	R ⇒ H;P	rs61761991	B-type natriuretic peptide to N-terminal pro B-type natriuretic peptide ratio	29237677
63	O-linked Glycosylation	72 (9)	R ⇒ H;P	rs61761991	B-type natriuretic peptide to N-terminal pro B-type natriuretic peptide ratio	29237677
70	O-linked Glycosylation	72 (2)	R ⇒ H;P	rs61761991	B-type natriuretic peptide to N-terminal pro B-type natriuretic peptide ratio	29237677
74	O-linked Glycosylation	72 (2)	R ⇒ H;P	rs61761991	B-type natriuretic peptide to N-terminal pro B-type natriuretic peptide ratio	29237677
79	O-linked Glycosylation	72 (7)	R ⇒ H;P	rs61761991	B-type natriuretic peptide to N-terminal pro B-type natriuretic peptide ratio	29237677

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HDAC4_HUMAN	HDAC4	physical	21464227
ANPRC_HUMAN	NPR3	physical	16870210
PSA3_HUMAN	PSMA3	physical	25416956
K1C40_HUMAN	KRT40	physical	25416956
KR109_HUMAN	KRTAP10-9	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ANFB_HUMAN

Related Literatures of Post-Translational Modification

O-linked Glycosylation
Reference	PubMed
"The precursor to B-type natriuretic peptide is an O-linkedglycoprotein."; Schellenberger U., O'Rear J., Guzzetta A., Jue R.A., Protter A.A.,Pollitt N.S.; Arch. Biochem. Biophys. 451:160-166(2006). Cited for: GLYCOSYLATION AT THR-62; SER-63; SER-70; THR-74; SER-79; THR-84 ANDTHR-97.	16750161 [Abstract]