UniProt ID | LEG7_HUMAN | |
---|---|---|
UniProt AC | P47929 | |
Protein Name | Galectin-7 | |
Gene Name | LGALS7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 136 | |
Subcellular Localization | Cytoplasm . Nucleus . Secreted . May be secreted by a non-classical secretory pathway. | |
Protein Description | Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.. | |
Protein Sequence | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSNVPHKSS ------CCCCCCCCC | 46.68 | 30631047 | |
9 | Phosphorylation | SNVPHKSSLPEGIRP CCCCCCCCCCCCCCC | 53.39 | 27251275 | |
18 | Phosphorylation | PEGIRPGTVLRIRGL CCCCCCCCEEEEECC | 21.03 | 27251275 | |
65 | Ubiquitination | SEVVFNSKEQGSWGR CEEEECCCCCCCCCC | 55.98 | 16196087 | |
69 | Phosphorylation | FNSKEQGSWGREERG ECCCCCCCCCCCCCC | 26.50 | 24719451 | |
107 | Phosphorylation | AVVGDAQYHHFRHRL EEECCHHHHHHHCCC | 10.05 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LEG7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LEG7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LEG7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TBA3C_HUMAN | TUBA3C | physical | 28514442 | |
UBP4_HUMAN | USP4 | physical | 28514442 | |
DPYL5_HUMAN | DPYSL5 | physical | 28514442 | |
DPYL4_HUMAN | DPYSL4 | physical | 28514442 | |
NAMPT_HUMAN | NAMPT | physical | 28514442 | |
DPYL2_HUMAN | DPYSL2 | physical | 28514442 | |
GAB1_HUMAN | GAB1 | physical | 28514442 | |
PK3C3_HUMAN | PIK3C3 | physical | 28514442 | |
DPOA2_HUMAN | POLA2 | physical | 28514442 | |
MKS1_HUMAN | MKS1 | physical | 28514442 | |
VP13B_HUMAN | VPS13B | physical | 28514442 | |
APAF_HUMAN | APAF1 | physical | 28514442 | |
TBB3_HUMAN | TUBB3 | physical | 28514442 | |
MTA70_HUMAN | METTL3 | physical | 28514442 | |
DPOE2_HUMAN | POLE2 | physical | 28514442 | |
PURA2_HUMAN | ADSS | physical | 28514442 | |
KLHL8_HUMAN | KLHL8 | physical | 28514442 | |
TBB8_HUMAN | TUBB8 | physical | 28514442 | |
RHEB_HUMAN | RHEB | physical | 28514442 | |
DOCK7_HUMAN | DOCK7 | physical | 28514442 | |
PALD_HUMAN | PALD1 | physical | 28514442 | |
TBA4A_HUMAN | TUBA4A | physical | 28514442 | |
INT14_HUMAN | VWA9 | physical | 28514442 | |
PAPD1_HUMAN | MTPAP | physical | 28514442 | |
PKN2_HUMAN | PKN2 | physical | 28514442 | |
DD19B_HUMAN | DDX19B | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...