LEG7_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LEG7_HUMAN
• UniProt AC: P47929
• Protein Name: Galectin-7
• Gene Name: LGALS7
• Organism: Homo sapiens (Human).
• Sequence Length: 136
• Subcellular Localization: Cytoplasm . Nucleus . Secreted . May be secreted by a non-classical secretory pathway.
• Protein Description: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release..
• Protein Sequence: MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSNVPHKSS ------CCCCCCCCC	46.68	30631047
9	Phosphorylation	SNVPHKSSLPEGIRP CCCCCCCCCCCCCCC	53.39	27251275
18	Phosphorylation	PEGIRPGTVLRIRGL CCCCCCCCEEEEECC	21.03	27251275
65	Ubiquitination	SEVVFNSKEQGSWGR CEEEECCCCCCCCCC	55.98	16196087
69	Phosphorylation	FNSKEQGSWGREERG ECCCCCCCCCCCCCC	26.50	24719451
107	Phosphorylation	AVVGDAQYHHFRHRL EEECCHHHHHHHCCC	10.05	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LEG7_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LEG7_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LEG7_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TBA3C_HUMAN	TUBA3C	physical	28514442
UBP4_HUMAN	USP4	physical	28514442
DPYL5_HUMAN	DPYSL5	physical	28514442
DPYL4_HUMAN	DPYSL4	physical	28514442
NAMPT_HUMAN	NAMPT	physical	28514442
DPYL2_HUMAN	DPYSL2	physical	28514442
GAB1_HUMAN	GAB1	physical	28514442
PK3C3_HUMAN	PIK3C3	physical	28514442
DPOA2_HUMAN	POLA2	physical	28514442
MKS1_HUMAN	MKS1	physical	28514442
VP13B_HUMAN	VPS13B	physical	28514442
APAF_HUMAN	APAF1	physical	28514442
TBB3_HUMAN	TUBB3	physical	28514442
MTA70_HUMAN	METTL3	physical	28514442
DPOE2_HUMAN	POLE2	physical	28514442
PURA2_HUMAN	ADSS	physical	28514442
KLHL8_HUMAN	KLHL8	physical	28514442
TBB8_HUMAN	TUBB8	physical	28514442
RHEB_HUMAN	RHEB	physical	28514442
DOCK7_HUMAN	DOCK7	physical	28514442
PALD_HUMAN	PALD1	physical	28514442
TBA4A_HUMAN	TUBA4A	physical	28514442
INT14_HUMAN	VWA9	physical	28514442
PAPD1_HUMAN	MTPAP	physical	28514442
PKN2_HUMAN	PKN2	physical	28514442
DD19B_HUMAN	DDX19B	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.