XP32_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: XP32_HUMAN
• UniProt AC: Q5T750
• Protein Name: Skin-specific protein 32
• Gene Name: XP32
• Organism: Homo sapiens (Human).
• Sequence Length: 250
• Protein Sequence: MCDQQKQPQFPPSCVKGSGLGAGQGSNGASVKCPVPCQTQTVCVTGPAPCPTQTYVKYQVPCQTQTYVKCPAPCQRTYVKYPTPCQTYVKCPAPCQTTYVKCPTPCQTYVKCPAPCQMTYIKSPAPCQTQTCYVQGASPCQSYYVQAPASGSTSQYCVTDPCSAPCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSGCCCLGIIPMRSRGPACCDHEDDCCC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
77	Phosphorylation	CPAPCQRTYVKYPTP CCCCCCCEEECCCCC	13.54	21712546
78	Phosphorylation	PAPCQRTYVKYPTPC CCCCCCEEECCCCCC	9.35	21712546
88	Phosphorylation	YPTPCQTYVKCPAPC CCCCCCEEEECCCCC	3.36	21712546
97	Phosphorylation	KCPAPCQTTYVKCPT ECCCCCCCEEEECCC	27.15	-
108	Phosphorylation	KCPTPCQTYVKCPAP ECCCCCCEEEECCCC	36.68	24719451
181	Phosphorylation	APRTFGVSPLRRWIQ CCCEECCCHHHHHHH	20.70	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of XP32_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of XP32_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of XP32_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of XP32_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.