UniProt ID | GA45A_HUMAN | |
---|---|---|
UniProt AC | P24522 | |
Protein Name | Growth arrest and DNA damage-inducible protein GADD45 alpha | |
Gene Name | GADD45A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 165 | |
Subcellular Localization | Nucleus . | |
Protein Description | In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity (By similarity). Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase.. | |
Protein Sequence | MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTLEEFSAG ------CCHHHCCCC | 42.76 | 23186163 | |
7 | Phosphorylation | -MTLEEFSAGEQKTE -CCHHHCCCCHHHHH | 38.35 | 23186163 | |
12 | Sumoylation | EFSAGEQKTERMDKV HCCCCHHHHHHHHHH | 48.31 | - | |
12 | Sumoylation | EFSAGEQKTERMDKV HCCCCHHHHHHHHHH | 48.31 | - | |
12 | Ubiquitination | EFSAGEQKTERMDKV HCCCCHHHHHHHHHH | 48.31 | 21906983 | |
18 | Ubiquitination | QKTERMDKVGDALEE HHHHHHHHHHHHHHH | 38.48 | 21906983 | |
29 | Ubiquitination | ALEEVLSKALSQRTI HHHHHHHHHHHCCCE | 49.54 | 21890473 | |
29 | Ubiquitination | ALEEVLSKALSQRTI HHHHHHHHHHHCCCE | 49.54 | 21890473 | |
32 | Phosphorylation | EVLSKALSQRTITVG HHHHHHHHCCCEEEE | 23.60 | - | |
41 | Phosphorylation | RTITVGVYEAAKLLN CCEEEEHHHHHHHCC | 8.23 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GA45A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GA45A_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...