dbPTM

GA45B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GA45B_HUMAN
UniProt AC	O75293
Protein Name	Growth arrest and DNA damage-inducible protein GADD45 beta
Gene Name	GADD45B
Organism	Homo sapiens (Human).
Sequence Length	160
Subcellular Localization
Protein Description	Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK..
Protein Sequence	MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Phosphorylation	------MTLEELVAC ------CCHHHHHHC	42.76	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GA45B_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GA45B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GA45B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
M3K5_HUMAN	MAP3K5	physical	14743220
G45IP_HUMAN	GADD45GIP1	physical	12716909
MP2K7_HUMAN	MAP2K7	physical	14743220
CDK1_HUMAN	CDK1	physical	12124778
CCNB1_HUMAN	CCNB1	physical	12124778
M3K4_HUMAN	MAP3K4	physical	28514442
CNOT2_HUMAN	CNOT2	physical	28514442
CNOT6_HUMAN	CNOT6	physical	28514442
IL36A_HUMAN	IL36A	physical	28514442
CNO6L_HUMAN	CNOT6L	physical	28514442
CNOT8_HUMAN	CNOT8	physical	28514442
CNO11_HUMAN	CNOT11	physical	28514442
CNOT1_HUMAN	CNOT1	physical	28514442
CNO10_HUMAN	CNOT10	physical	28514442
CNOT9_HUMAN	RQCD1	physical	28514442
TB182_HUMAN	TNKS1BP1	physical	28514442
CNOT3_HUMAN	CNOT3	physical	28514442
CNOT7_HUMAN	CNOT7	physical	28514442
RAVR1_HUMAN	RAVER1	physical	28514442
RPC3_HUMAN	POLR3C	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GA45B_HUMAN

Related Literatures of Post-Translational Modification