UniProt ID | CNOT8_HUMAN | |
---|---|---|
UniProt AC | Q9UFF9 | |
Protein Name | CCR4-NOT transcription complex subunit 8 | |
Gene Name | CNOT8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 292 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT7. Catalytic component of the CCR4-NOT complex which is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.. | |
Protein Sequence | MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
56 | Phosphorylation | RPIGEFRSSIDYQYQ EECCHHHCHHHHHHH | 36.65 | 24043423 | |
57 | Phosphorylation | PIGEFRSSIDYQYQL ECCHHHCHHHHHHHH | 18.41 | 24043423 | |
60 | Phosphorylation | EFRSSIDYQYQLLRC HHHCHHHHHHHHHHC | 13.88 | 24043423 | |
62 | Phosphorylation | RSSIDYQYQLLRCNV HCHHHHHHHHHHCCC | 8.56 | 24043423 | |
94 | Ubiquitination | EYPSGINTWQFNFKF CCCCCCEEEEEEEEE | 20.79 | - | |
100 | Ubiquitination | NTWQFNFKFNLTEDM EEEEEEEEEECCCCC | 34.15 | - | |
108 | Phosphorylation | FNLTEDMYSQDSIDL EECCCCCCCHHHHHH | 18.59 | 22817900 | |
112 | Phosphorylation | EDMYSQDSIDLLANS CCCCCHHHHHHHHHC | 15.46 | 28188228 | |
119 | Phosphorylation | SIDLLANSGLQFQKH HHHHHHHCCCCCCCH | 34.96 | 28188228 | |
136 | Ubiquitination | EGIDTLHFAELLMTS CCCCHHHHHHHHHHC | 6.76 | - | |
148 | Ubiquitination | MTSGVVLCDNVKWLS HHCCEEEECCCEEEE | 2.12 | - | |
163 | Ubiquitination | FHSGYDFGYMVKLLT ECCCCCHHHHHHHHH | 13.51 | - | |
174 | Ubiquitination | KLLTDSRLPEEEHEF HHHHCCCCCHHHHHH | 7.88 | - | |
197 | Phosphorylation | PSIYDVKYLMKSCKN CCHHCHHHHHHHHCC | 16.33 | 24260401 | |
200 | Ubiquitination | YDVKYLMKSCKNLKG HCHHHHHHHHCCCCC | 50.54 | - | |
206 | Ubiquitination | MKSCKNLKGGLQEVA HHHHCCCCCHHHHHH | 61.40 | 21890473 | |
206 | Ubiquitination | MKSCKNLKGGLQEVA HHHHCCCCCHHHHHH | 61.40 | 21890473 | |
206 | Ubiquitination | MKSCKNLKGGLQEVA HHHHCCCCCHHHHHH | 61.40 | 21890473 | |
231 | Phosphorylation | QHQAGSDSLLTGMAF CCCCCCCCHHHHHHH | 27.29 | - | |
234 | Phosphorylation | AGSDSLLTGMAFFRM CCCCCHHHHHHHHHH | 30.15 | - | |
242 | Ubiquitination | GMAFFRMKELFFEDS HHHHHHHHHHHCCCC | 47.19 | 21890473 | |
249 | Phosphorylation | KELFFEDSIDDAKYC HHHHCCCCCCCHHHH | 22.25 | 29514088 | |
254 | Ubiquitination | EDSIDDAKYCGRLYG CCCCCCHHHHHHHHC | 48.33 | - | |
260 | Phosphorylation | AKYCGRLYGLGTGVA HHHHHHHHCCCCCCC | 14.67 | 28152594 | |
269 | Ubiquitination | LGTGVAQKQNEDVDS CCCCCCHHCCCCCCH | 45.40 | 21890473 | |
280 | Ubiquitination | DVDSAQEKMSILAII CCCHHHHHHHHHHHH | 26.35 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNOT8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNOT8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNOT8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CNOT1_HUMAN | CNOT1 | physical | 17353931 | |
CNO10_HUMAN | CNOT10 | physical | 17353931 | |
MCM7_HUMAN | MCM7 | physical | 17353931 | |
BTG1_HUMAN | BTG1 | physical | 11136725 | |
BTG2_HUMAN | BTG2 | physical | 11136725 | |
CNOT3_HUMAN | CNOT3 | physical | 10637334 | |
ANM1_HUMAN | PRMT1 | physical | 17264152 | |
TOB2_HUMAN | TOB2 | physical | 25416956 | |
CNOT1_HUMAN | CNOT1 | physical | 16778766 | |
CNOT3_HUMAN | CNOT3 | physical | 16778766 | |
CNOT2_HUMAN | CNOT2 | physical | 16778766 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...