BTG2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BTG2_HUMAN
• UniProt AC: P78543
• Protein Name: Protein BTG2
• Gene Name: BTG2
• Organism: Homo sapiens (Human).
• Sequence Length: 158
• Protein Description: Anti-proliferative protein; the function is mediated by association with deadenylase subunits of the CCR4-NOT complex. Activates mRNA deadenylation in a CNOT6 and CNOT7-dependent manner. In vitro can inhibit deadenylase activity of CNOT7 and CNOT8. Involved in cell cycle regulation. Could be involved in the growth arrest and differentiation of the neuronal precursors (By similarity). Modulates transcription regulation mediated by ESR1. Involved in mitochondrial depolarization and neurite outgrowth..
• Protein Sequence: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Phosphorylation	AAVGFLSSLLRTRGC HHHHHHHHHHHHCCC	33.30	24719451
58	Ubiquitination	KHHWFPEKPSKGSGY HHHCCCCCCCCCCCC	55.62	29967540
79	O-linked_Glycosylation	HKMDPIISRVASQIG CCCCHHHHHHHHHHC	22.79	29351928
83	O-linked_Glycosylation	PIISRVASQIGLSQP HHHHHHHHHHCCCHH	21.34	29351928
146	Phosphorylation	NQVLLGRSSPSKNYV CCEEECCCCCCCCEE	44.81	25849741
147	Phosphorylation	QVLLGRSSPSKNYVM CEEECCCCCCCCEEE	31.65	25849741
149	Phosphorylation	LLGRSSPSKNYVMAV EECCCCCCCCEEEEE	35.17	15788397

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
147	S	Phosphorylation	Kinase	MAPK1	P28482	Uniprot
147	S	Phosphorylation	Kinase	MAPK3	P27361	Uniprot
149	S	Phosphorylation	Kinase	MAPK14	Q16539	Uniprot
-	K	Ubiquitination	E3 ubiquitin ligase	BTRC	Q9Y297	PMID:24658274
-	K	Ubiquitination	E3 ubiquitin ligase	SKP2	Q13309	PMID:19615363

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
147	S	Phosphorylation	Phosphorylated at Ser-147 by MAPK1/ERK2 and MAPK3/ERK1, and at Ser-149 by MAPK14, leading to PIN1-binding and mitochondrial depolarization.	15788397
149	S	Phosphorylation	Phosphorylated at Ser-147 by MAPK1/ERK2 and MAPK3/ERK1, and at Ser-149 by MAPK14, leading to PIN1-binding and mitochondrial depolarization.	15788397

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BTG2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CNOT1_HUMAN	CNOT1	physical	17353931
CNO6L_HUMAN	CNOT6L	physical	17353931
ANM1_HUMAN	PRMT1	physical	8663146
ANM1_HUMAN	PRMT1	physical	11856371
PICK1_RAT	Pick1	physical	11237868
CNOT8_HUMAN	CNOT8	physical	11136725
HXC8_HUMAN	HOXC8	physical	10617598
CNOT7_MOUSE	Cnot7	physical	9712883
SKP2_HUMAN	SKP2	physical	19615363
CUL1_HUMAN	CUL1	physical	22975506
SKP1_HUMAN	SKP1	physical	22975506
SKP2_HUMAN	SKP2	physical	22975506
SRA1_HUMAN	SRA1	physical	20398657
CNOT8_HUMAN	CNOT8	physical	25416956
CNOT7_HUMAN	CNOT7	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphorylation of serine 147 of tis21/BTG2/pc3 by p-Erk1/2 inducesPin-1 binding in cytoplasm and cell death.";
Hong J.W., Ryu M.S., Lim I.K.;
J. Biol. Chem. 280:21256-21263(2005).
Cited for: PHOSPHORYLATION AT SER-147 AND SER-149, MUTAGENESIS OF SER-147;PRO-148 AND SER-149, INTERACTION WITH PIN1, AND FUNCTION.
PubMed: 15788397