UniProt ID | HXC8_HUMAN | |
---|---|---|
UniProt AC | P31273 | |
Protein Name | Homeobox protein Hox-C8 | |
Gene Name | HOXC8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 242 | |
Subcellular Localization | Nucleus. | |
Protein Description | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.. | |
Protein Sequence | MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSYFVNPL ------CCCCCCCHH | 33.47 | 25072903 | |
3 | Phosphorylation | -----MSSYFVNPLF -----CCCCCCCHHH | 22.69 | 25072903 | |
4 | Phosphorylation | ----MSSYFVNPLFS ----CCCCCCCHHHH | 12.30 | 23663014 | |
11 | Phosphorylation | YFVNPLFSKYKAGES CCCCHHHHCCCCCCC | 42.64 | 23663014 | |
13 | Phosphorylation | VNPLFSKYKAGESLE CCHHHHCCCCCCCCC | 12.60 | 25072903 | |
23 | Phosphorylation | GESLEPAYYDCRFPQ CCCCCCCEECCCCCC | 15.56 | - | |
91 | Phosphorylation | DASKFYGYEALPRQS CHHHHCCCCCCCCCC | 6.15 | 27642862 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXC8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXC8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXC8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SMAD6_HUMAN | SMAD6 | physical | 10722652 | |
SMAD1_HUMAN | SMAD1 | physical | 10224145 | |
SMAD4_HUMAN | SMAD4 | physical | 10224145 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...