HXC8_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HXC8_HUMAN
• UniProt AC: P31273
• Protein Name: Homeobox protein Hox-C8
• Gene Name: HOXC8
• Organism: Homo sapiens (Human).
• Sequence Length: 242
• Subcellular Localization: Nucleus.
• Protein Description: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis..
• Protein Sequence: MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSSYFVNPL ------CCCCCCCHH	33.47	25072903
3	Phosphorylation	-----MSSYFVNPLF -----CCCCCCCHHH	22.69	25072903
4	Phosphorylation	----MSSYFVNPLFS ----CCCCCCCHHHH	12.30	23663014
11	Phosphorylation	YFVNPLFSKYKAGES CCCCHHHHCCCCCCC	42.64	23663014
13	Phosphorylation	VNPLFSKYKAGESLE CCHHHHCCCCCCCCC	12.60	25072903
23	Phosphorylation	GESLEPAYYDCRFPQ CCCCCCCEECCCCCC	15.56	-
91	Phosphorylation	DASKFYGYEALPRQS CHHHHCCCCCCCCCC	6.15	27642862

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HXC8_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HXC8_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HXC8_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SMAD6_HUMAN	SMAD6	physical	10722652
SMAD1_HUMAN	SMAD1	physical	10224145
SMAD4_HUMAN	SMAD4	physical	10224145

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.