| UniProt ID | CNOT7_HUMAN | |
|---|---|---|
| UniProt AC | Q9UIV1 | |
| Protein Name | CCR4-NOT transcription complex subunit 7 | |
| Gene Name | CNOT7 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 285 | |
| Subcellular Localization | Nucleus. Cytoplasm, P-body. NANOS2 promotes its localization to P-body.. | |
| Protein Description | Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.. | |
| Protein Sequence | MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | PAATVDHSQRICEVW CCCCCCHHHHHHHHH | 19.38 | 24043423 | |
| 33 | Ubiquitination | KIRQVIRKYNYVAMD HHHHHHHHCCCEEEC | 27.07 | - | |
| 34 | Phosphorylation | IRQVIRKYNYVAMDT HHHHHHHCCCEEECC | 11.24 | 25262027 | |
| 36 | Phosphorylation | QVIRKYNYVAMDTEF HHHHHCCCEEECCCC | 6.11 | 25262027 | |
| 41 | Phosphorylation | YNYVAMDTEFPGVVA CCCEEECCCCCCEEE | 26.83 | 25262027 | |
| 193 | Phosphorylation | RLFFPVIYDVKYLMK HHHHHHHHCHHHHHH | 18.21 | 21406692 | |
| 197 | Phosphorylation | PVIYDVKYLMKSCKN HHHHCHHHHHHHCCC | 16.33 | 24260401 | |
| 200 | Acetylation | YDVKYLMKSCKNLKG HCHHHHHHHCCCCCC | 50.54 | 118235201 | |
| 200 | Ubiquitination | YDVKYLMKSCKNLKG HCHHHHHHHCCCCCC | 50.54 | - | |
| 206 | Acetylation | MKSCKNLKGGLQEVA HHHCCCCCCHHHHHH | 61.40 | 118235199 | |
| 206 | Ubiquitination | MKSCKNLKGGLQEVA HHHCCCCCCHHHHHH | 61.40 | 21906983 | |
| 231 | Phosphorylation | QHQAGSDSLLTGMAF CCCCCCCCHHHHHHH | 27.29 | - | |
| 234 | Phosphorylation | AGSDSLLTGMAFFKM CCCCCHHHHHHHHHH | 30.15 | - | |
| 240 | Ubiquitination | LTGMAFFKMREMFFE HHHHHHHHHHHHHHH | 30.51 | - | |
| 260 | Phosphorylation | AKYCGHLYGLGSGSS CCCCCCCCCCCCCCC | 12.48 | 20090780 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNOT7_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNOT7_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNOT7_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
