UniProt ID | IL36A_HUMAN | |
---|---|---|
UniProt AC | Q9UHA7 | |
Protein Name | Interleukin-36 alpha | |
Gene Name | IL36A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 158 | |
Subcellular Localization | Secreted . | |
Protein Description | Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6. In cultured monocytes upregulates expression of IL-1A, IL-1B and IL-6. In myeloid dendritic cells involved in cell maturation by upregulating surface expression of CD83, CD86 and HLA-DR. In monocyte-derived dendritic cells facilitates dendritic cell maturation and drives T-cell proliferation. May play a role in proinflammatory effects in the lung.. | |
Protein Sequence | MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | EKALKIDTPQQGSIQ CCCCCCCCCCCCCCE | 26.86 | 21299198 | |
40 | Phosphorylation | VPRKDRMSPVTIALI EECCCCCCHHEEEEE | 19.67 | 30257219 | |
43 | Phosphorylation | KDRMSPVTIALISCR CCCCCHHEEEEEECC | 12.15 | 28634298 | |
48 | Phosphorylation | PVTIALISCRHVETL HHEEEEEECCCHHHH | 13.12 | 26434552 | |
54 | Phosphorylation | ISCRHVETLEKDRGN EECCCHHHHHHHCCC | 38.84 | 28634298 | |
88 | Ubiquitination | DQPTLQLKEKDIMDL CCCEEECCHHHHHHH | 50.16 | 29967540 | |
96 | Nitrated tyrosine | EKDIMDLYNQPEPVK HHHHHHHHCCCCCCC | 13.90 | - | |
96 | Phosphorylation | EKDIMDLYNQPEPVK HHHHHHHHCCCCCCC | 13.90 | 19658100 | |
96 | Nitration | EKDIMDLYNQPEPVK HHHHHHHHCCCCCCC | 13.90 | 16777052 | |
96 | Nitration | EKDIMDLYNQPEPVK HHHHHHHHCCCCCCC | 13.90 | 16777052 | |
104 | Phosphorylation | NQPEPVKSFLFYHSQ CCCCCCCEEEEEECC | 27.67 | 30206219 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL36A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL36A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL36A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BRE1A_HUMAN | RNF20 | physical | 26186194 | |
BRE1B_HUMAN | RNF40 | physical | 26186194 | |
CARM1_HUMAN | CARM1 | physical | 26186194 | |
CTF8_HUMAN | CHTF8 | physical | 26186194 | |
BRE1A_HUMAN | RNF20 | physical | 28514442 | |
CTF8_HUMAN | CHTF8 | physical | 28514442 | |
BRE1B_HUMAN | RNF40 | physical | 28514442 | |
EF1A2_HUMAN | EEF1A2 | physical | 28514442 | |
ACTA_HUMAN | ACTA2 | physical | 28514442 | |
ACTBL_HUMAN | ACTBL2 | physical | 28514442 | |
TLK2_HUMAN | TLK2 | physical | 28514442 | |
CARM1_HUMAN | CARM1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Nitration | |
Reference | PubMed |
"Nitroproteins from a human pituitary adenoma tissue discovered with anitrotyrosine affinity column and tandem mass spectrometry."; Zhan X., Desiderio D.M.; Anal. Biochem. 354:279-289(2006). Cited for: NITRATION [LARGE SCALE ANALYSIS] AT TYR-96, AND MASS SPECTROMETRY. |