ERG28_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ERG28_HUMAN
• UniProt AC: Q9UKR5
• Protein Name: Probable ergosterol biosynthetic protein 28
• Gene Name: ERG28 {ECO:0000312|HGNC:HGNC:1187}
• Organism: Homo sapiens (Human).
• Sequence Length: 140
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Sequence: MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSRFLNVLR ------CCHHHHHHH	31.57	20068231
10	Phosphorylation	RFLNVLRSWLVMVSI HHHHHHHHHHHHHHH	22.17	20068231
16	Phosphorylation	RSWLVMVSIIAMGNT HHHHHHHHHHHHCCH	7.09	20068231
23	Phosphorylation	SIIAMGNTLQSFRDH HHHHHCCHHHHHHHH	22.05	20068231
26	Phosphorylation	AMGNTLQSFRDHTFL HHCCHHHHHHHHHHH	25.92	20068231
41	Ubiquitination	YEKLYTGKPNLVNGL HHHHHCCCCCHHCCH	23.96	-
134	Phosphorylation	YLEVEPVSRQKKRN- HHHCCCCCCCHHCC-	39.44	21815630

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ERG28_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ERG28_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ERG28_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ERG28_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.