| UniProt ID | TETN_HUMAN | |
|---|---|---|
| UniProt AC | P05452 | |
| Protein Name | Tetranectin | |
| Gene Name | CLEC3B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 202 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Tetranectin binds to plasminogen and to isolated kringle 4. May be involved in the packaging of molecules destined for exocytosis.. | |
| Protein Sequence | MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MELWGAYLLLCLFS -CCHHHHHHHHHHHH | 8.24 | 26552605 | |
| 14 | Phosphorylation | YLLLCLFSLLTQVTT HHHHHHHHHHHCCCC | 14.99 | 26552605 | |
| 17 | Phosphorylation | LCLFSLLTQVTTEPP HHHHHHHHCCCCCCC | 26.70 | 26552605 | |
| 20 | Phosphorylation | FSLLTQVTTEPPTQK HHHHHCCCCCCCCCC | 18.67 | 26552605 | |
| 21 | Phosphorylation | SLLTQVTTEPPTQKP HHHHCCCCCCCCCCC | 47.87 | 26552605 | |
| 25 | O-linked_Glycosylation | QVTTEPPTQKPKKIV CCCCCCCCCCCHHHH | 61.00 | 10614823 | |
| 25 | O-linked_Glycosylation | QVTTEPPTQKPKKIV CCCCCCCCCCCHHHH | 61.00 | 10614823 | |
| 25 | Phosphorylation | QVTTEPPTQKPKKIV CCCCCCCCCCCHHHH | 61.00 | 26552605 | |
| 107 | Phosphorylation | SRGGTLGTPQTGSEN HCCCCCCCCCCCCCH | 18.48 | 26853621 | |
| 124 | Phosphorylation | LYEYLRQSVGNEAEI HHHHHHHHCCCCCEE | 26.09 | 22210691 | |
| 143 | Phosphorylation | NDMAAEGTWVDMTGA CHHHCCCEEEECCCC | 17.51 | 22210691 | |
| 148 | Phosphorylation | EGTWVDMTGARIAYK CCEEEECCCCEEEEC | 24.19 | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TETN_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TETN_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TETN_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| OSTF1_HUMAN | OSTF1 | physical | 17353931 | |
| K1C18_HUMAN | KRT18 | physical | 17353931 | |
| OTUD4_HUMAN | OTUD4 | physical | 17353931 | |
| TR150_HUMAN | THRAP3 | physical | 17353931 | |
| TPA_HUMAN | PLAT | physical | 12694198 | |
| HGF_HUMAN | HGF | physical | 12694198 | |
| A4_HUMAN | APP | physical | 21832049 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
