UniProt ID | TRY3_HUMAN | |
---|---|---|
UniProt AC | P35030 | |
Protein Name | Trypsin-3 | |
Gene Name | PRSS3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 304 | |
Subcellular Localization | Secreted. | |
Protein Description | Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.. | |
Protein Sequence | MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAARDADGCEALGTVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
92 (in isoform 3) | Ubiquitination | - | 7.45 | 21906983 | |
92 | Ubiquitination | YTCEENSLPYQVSLN EEECCCCCCEEEECC | 7.45 | 21906983 | |
105 (in isoform 2) | Ubiquitination | - | 5.16 | 21906983 | |
112 (in isoform 3) | Ubiquitination | - | 41.28 | 21906983 | |
112 | Ubiquitination | CGGSLISEQWVVSAA CCCCCCCCEEEEEHH | 41.28 | 21906983 | |
125 (in isoform 2) | Ubiquitination | - | 17.12 | 21906983 | |
136 | Acetylation | RLGEHNIKVLEGNEQ EECCCCEEEEECCHH | 46.19 | 19666629 | |
149 | Ubiquitination | EQFINAAKIIRHPKY HHHHHHHHHHHCCCC | 35.93 | - | |
149 (in isoform 1) | Ubiquitination | - | 35.93 | 21906983 | |
155 | Ubiquitination | AKIIRHPKYNRDTLD HHHHHCCCCCCCCCC | 49.37 | - | |
169 | Ubiquitination | DNDIMLIKLSSPAVI CCCEEEEECCCCEEE | 38.05 | 2190698 | |
169 (in isoform 1) | Ubiquitination | - | 38.05 | 21906983 | |
211 | Sulfation | TLSFGADYPDELKCL EEEECCCCCCCCEEC | 16.43 | - | |
211 | Sulfation | TLSFGADYPDELKCL EEEECCCCCCCCEEC | 16.43 | - | |
232 | Phosphorylation | QAECKASYPGKITNS CHHHHHCCCCCCCCC | 22.36 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRY3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRY3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRY3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TFPI1_HUMAN | TFPI | physical | 7498454 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...