| UniProt ID | TRY3_HUMAN | |
|---|---|---|
| UniProt AC | P35030 | |
| Protein Name | Trypsin-3 | |
| Gene Name | PRSS3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 304 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.. | |
| Protein Sequence | MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAARDADGCEALGTVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 92 (in isoform 3) | Ubiquitination | - | 7.45 | 21906983 | |
| 92 | Ubiquitination | YTCEENSLPYQVSLN EEECCCCCCEEEECC | 7.45 | 21906983 | |
| 105 (in isoform 2) | Ubiquitination | - | 5.16 | 21906983 | |
| 112 (in isoform 3) | Ubiquitination | - | 41.28 | 21906983 | |
| 112 | Ubiquitination | CGGSLISEQWVVSAA CCCCCCCCEEEEEHH | 41.28 | 21906983 | |
| 125 (in isoform 2) | Ubiquitination | - | 17.12 | 21906983 | |
| 136 | Acetylation | RLGEHNIKVLEGNEQ EECCCCEEEEECCHH | 46.19 | 19666629 | |
| 149 | Ubiquitination | EQFINAAKIIRHPKY HHHHHHHHHHHCCCC | 35.93 | - | |
| 149 (in isoform 1) | Ubiquitination | - | 35.93 | 21906983 | |
| 155 | Ubiquitination | AKIIRHPKYNRDTLD HHHHHCCCCCCCCCC | 49.37 | - | |
| 169 | Ubiquitination | DNDIMLIKLSSPAVI CCCEEEEECCCCEEE | 38.05 | 2190698 | |
| 169 (in isoform 1) | Ubiquitination | - | 38.05 | 21906983 | |
| 211 | Sulfation | TLSFGADYPDELKCL EEEECCCCCCCCEEC | 16.43 | - | |
| 211 | Sulfation | TLSFGADYPDELKCL EEEECCCCCCCCEEC | 16.43 | - | |
| 232 | Phosphorylation | QAECKASYPGKITNS CHHHHHCCCCCCCCC | 22.36 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRY3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRY3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRY3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TFPI1_HUMAN | TFPI | physical | 7498454 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
