| UniProt ID | CALL5_HUMAN | |
|---|---|---|
| UniProt AC | Q9NZT1 | |
| Protein Name | Calmodulin-like protein 5 | |
| Gene Name | CALML5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 146 | |
| Subcellular Localization | ||
| Protein Description | Binds calcium. May be involved in terminal differentiation of keratinocytes.. | |
| Protein Sequence | MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAGELTPEE ------CCCCCCHHH | 21.84 | - | |
| 6 | Phosphorylation | --MAGELTPEEEAQY --CCCCCCHHHHHHH | 25.09 | 20068231 | |
| 13 | Phosphorylation | TPEEEAQYKKAFSAV CHHHHHHHHHHHHCC | 22.85 | 20068231 | |
| 18 | Phosphorylation | AQYKKAFSAVDTDGN HHHHHHHHCCCCCCC | 32.04 | 20068231 | |
| 22 | Phosphorylation | KAFSAVDTDGNGTIN HHHHCCCCCCCCEEC | 38.93 | 20068231 | |
| 27 | Phosphorylation | VDTDGNGTINAQELG CCCCCCCEECHHHHH | 18.30 | 20068231 | |
| 45 | Phosphorylation | KATGKNLSEAQLRKL HHHCCCCCHHHHHHH | 40.04 | 25849741 | |
| 58 | Phosphorylation | KLISEVDSDGDGEIS HHHHHCCCCCCCCCC | 48.98 | 26657352 | |
| 65 | Phosphorylation | SDGDGEISFQEFLTA CCCCCCCCHHHHHHH | 19.30 | 24719451 | |
| 136 | Phosphorylation | DQDGRVNYEEFARML CCCCCCCHHHHHHHH | 17.61 | 25106551 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CALL5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CALL5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CALL5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CALL5_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
