UniProt ID | LDHA_HUMAN | |
---|---|---|
UniProt AC | P00338 | |
Protein Name | L-lactate dehydrogenase A chain | |
Gene Name | LDHA | |
Organism | Homo sapiens (Human). | |
Sequence Length | 332 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATLKDQLI ------CCCHHHHHH | 22.95 | 22223895 | |
3 | Phosphorylation | -----MATLKDQLIY -----CCCHHHHHHH | 32.80 | 28857561 | |
5 | Ubiquitination | ---MATLKDQLIYNL ---CCCHHHHHHHHH | 38.79 | 21890473 | |
5 | Acetylation | ---MATLKDQLIYNL ---CCCHHHHHHHHH | 38.79 | 19608861 | |
5 | Methylation | ---MATLKDQLIYNL ---CCCHHHHHHHHH | 38.79 | 19608861 | |
5 | Succinylation | ---MATLKDQLIYNL ---CCCHHHHHHHHH | 38.79 | - | |
5 | Succinylation | ---MATLKDQLIYNL ---CCCHHHHHHHHH | 38.79 | 23954790 | |
5 | Ubiquitination | ---MATLKDQLIYNL ---CCCHHHHHHHHH | 38.79 | 21890473 | |
10 | Nitration | TLKDQLIYNLLKEEQ CHHHHHHHHHHHHCC | 14.35 | - | |
10 | Phosphorylation | TLKDQLIYNLLKEEQ CHHHHHHHHHHHHCC | 14.35 | 21945579 | |
14 | Ubiquitination | QLIYNLLKEEQTPQN HHHHHHHHHCCCCCC | 63.47 | 21890473 | |
14 | Acetylation | QLIYNLLKEEQTPQN HHHHHHHHHCCCCCC | 63.47 | 19608861 | |
14 | Succinylation | QLIYNLLKEEQTPQN HHHHHHHHHCCCCCC | 63.47 | 23954790 | |
14 | Sumoylation | QLIYNLLKEEQTPQN HHHHHHHHHCCCCCC | 63.47 | 19608861 | |
14 | Ubiquitination | QLIYNLLKEEQTPQN HHHHHHHHHCCCCCC | 63.47 | 21890473 | |
14 (in isoform 1) | Ubiquitination | - | 63.47 | 21890473 | |
14 (in isoform 2) | Ubiquitination | - | 63.47 | 21890473 | |
18 | Phosphorylation | NLLKEEQTPQNKITV HHHHHCCCCCCCEEE | 30.07 | 21945579 | |
22 | Acetylation | EEQTPQNKITVVGVG HCCCCCCCEEEEECH | 34.21 | 69955 | |
24 | Phosphorylation | QTPQNKITVVGVGAV CCCCCCEEEEECHHH | 15.68 | 20860994 | |
27 | Ubiquitination | QNKITVVGVGAVGMA CCCEEEEECHHHHHH | 14.06 | - | |
27 (in isoform 3) | Ubiquitination | - | 14.06 | - | |
34 (in isoform 3) | Ubiquitination | - | 3.60 | - | |
39 | Phosphorylation | GMACAISILMKDLAD HHHHHHHHHHHHHHH | 3.40 | 27642862 | |
43 | Acetylation | AISILMKDLADELAL HHHHHHHHHHHHHHH | 32.88 | 19608861 | |
43 | Ubiquitination | AISILMKDLADELAL HHHHHHHHHHHHHHH | 32.88 | 19608861 | |
43 (in isoform 3) | Ubiquitination | - | 32.88 | - | |
57 | Acetylation | LVDVIEDKLKGEMMD HHHHHHHHHCCCCEE | 39.03 | 19608861 | |
57 | Sumoylation | LVDVIEDKLKGEMMD HHHHHHHHHCCCCEE | 39.03 | 28112733 | |
57 | Ubiquitination | LVDVIEDKLKGEMMD HHHHHHHHHCCCCEE | 39.03 | 21906983 | |
57 (in isoform 2) | Ubiquitination | - | 39.03 | 21890473 | |
59 | Ubiquitination | DVIEDKLKGEMMDLQ HHHHHHHCCCCEECC | 59.57 | 21890473 | |
59 | Acetylation | DVIEDKLKGEMMDLQ HHHHHHHCCCCEECC | 59.57 | 26051181 | |
59 | Malonylation | DVIEDKLKGEMMDLQ HHHHHHHCCCCEECC | 59.57 | 33225896 | |
59 | Ubiquitination | DVIEDKLKGEMMDLQ HHHHHHHCCCCEECC | 59.57 | 21890473 | |
59 (in isoform 1) | Ubiquitination | - | 59.57 | 21890473 | |
59 (in isoform 2) | Ubiquitination | - | 59.57 | 21890473 | |
62 | Sulfoxidation | EDKLKGEMMDLQHGS HHHHCCCCEECCCCC | 3.27 | 28465586 | |
63 | Sulfoxidation | DKLKGEMMDLQHGSL HHHCCCCEECCCCCE | 3.96 | 28465586 | |
69 | O-linked_Glycosylation | MMDLQHGSLFLRTPK CEECCCCCEEEECCC | 17.52 | 31373491 | |
69 | Phosphorylation | MMDLQHGSLFLRTPK CEECCCCCEEEECCC | 17.52 | 27080861 | |
74 | Phosphorylation | HGSLFLRTPKIVSGK CCCEEEECCCCCCCC | 30.95 | - | |
76 | Ubiquitination | SLFLRTPKIVSGKDY CEEEECCCCCCCCCC | 55.94 | 21890473 | |
76 (in isoform 1) | Ubiquitination | - | 55.94 | 21890473 | |
76 (in isoform 2) | Ubiquitination | - | 55.94 | 21890473 | |
79 | Phosphorylation | LRTPKIVSGKDYNVT EECCCCCCCCCCEEC | 43.53 | 28152594 | |
81 | Acetylation | TPKIVSGKDYNVTAN CCCCCCCCCCEECCC | 49.92 | 19608861 | |
81 | Malonylation | TPKIVSGKDYNVTAN CCCCCCCCCCEECCC | 49.92 | 33225896 | |
81 | Ubiquitination | TPKIVSGKDYNVTAN CCCCCCCCCCEECCC | 49.92 | 20639865 | |
81 (in isoform 1) | Ubiquitination | - | 49.92 | 21890473 | |
81 (in isoform 2) | Ubiquitination | - | 49.92 | 21890473 | |
83 | Phosphorylation | KIVSGKDYNVTANSK CCCCCCCCEECCCCE | 18.28 | 28152594 | |
86 | Acetylation | SGKDYNVTANSKLVI CCCCCEECCCCEEEE | 19.24 | 19608861 | |
86 | Phosphorylation | SGKDYNVTANSKLVI CCCCCEECCCCEEEE | 19.24 | 26437602 | |
86 | Ubiquitination | SGKDYNVTANSKLVI CCCCCEECCCCEEEE | 19.24 | 19608861 | |
88 | Ubiquitination | KDYNVTANSKLVIIT CCCEECCCCEEEEEE | 30.25 | 21890473 | |
88 (in isoform 3) | Ubiquitination | - | 30.25 | - | |
89 | Phosphorylation | DYNVTANSKLVIITA CCEECCCCEEEEEEC | 25.54 | 28152594 | |
90 | Ubiquitination | YNVTANSKLVIITAG CEECCCCEEEEEECC | 46.73 | 90473 | |
90 (in isoform 2) | Ubiquitination | - | 46.73 | 21890473 | |
95 | Phosphorylation | NSKLVIITAGARQQE CCEEEEEECCCCCCH | 14.12 | 28857561 | |
97 | Ubiquitination | KLVIITAGARQQEGE EEEEEECCCCCCHHC | 16.79 | 21890473 | |
105 | Ubiquitination | ARQQEGESRLNLVQR CCCCHHCHHHHHHHH | 53.58 | 21890473 | |
105 | Phosphorylation | ARQQEGESRLNLVQR CCCCHHCHHHHHHHH | 53.58 | 30622161 | |
105 (in isoform 3) | Ubiquitination | - | 53.58 | - | |
110 | Ubiquitination | GESRLNLVQRNVNIF HCHHHHHHHHHHCCH | 4.97 | 21890473 | |
110 | Acetylation | GESRLNLVQRNVNIF HCHHHHHHHHHHCCH | 4.97 | 19608861 | |
110 | Ubiquitination | GESRLNLVQRNVNIF HCHHHHHHHHHHCCH | 4.97 | 19608861 | |
110 (in isoform 3) | Ubiquitination | - | 4.97 | - | |
112 | Phosphorylation | SRLNLVQRNVNIFKF HHHHHHHHHHCCHHH | 41.40 | 27642862 | |
115 | Phosphorylation | NLVQRNVNIFKFIIP HHHHHHHCCHHHHCC | 37.21 | 27251275 | |
118 | Acetylation | QRNVNIFKFIIPNVV HHHHCCHHHHCCCCE | 31.68 | 19608861 | |
118 | Methylation | QRNVNIFKFIIPNVV HHHHCCHHHHCCCCE | 31.68 | 88375 | |
118 | Succinylation | QRNVNIFKFIIPNVV HHHHCCHHHHCCCCE | 31.68 | - | |
118 | Succinylation | QRNVNIFKFIIPNVV HHHHCCHHHHCCCCE | 31.68 | 23954790 | |
118 | Ubiquitination | QRNVNIFKFIIPNVV HHHHCCHHHHCCCCE | 31.68 | 19608861 | |
118 (in isoform 1) | Ubiquitination | - | 31.68 | 21890473 | |
118 (in isoform 2) | Ubiquitination | - | 31.68 | 21890473 | |
124 | Phosphorylation | FKFIIPNVVKYSPNC HHHHCCCCEEECCCC | 3.09 | 27251275 | |
126 | Acetylation | FIIPNVVKYSPNCKL HHCCCCEEECCCCEE | 35.41 | 19608861 | |
126 | Malonylation | FIIPNVVKYSPNCKL HHCCCCEEECCCCEE | 35.41 | 26320211 | |
126 | Ubiquitination | FIIPNVVKYSPNCKL HHCCCCEEECCCCEE | 35.41 | 21890473 | |
126 (in isoform 1) | Ubiquitination | - | 35.41 | 21890473 | |
126 (in isoform 2) | Ubiquitination | - | 35.41 | 21890473 | |
127 | Phosphorylation | IIPNVVKYSPNCKLL HCCCCEEECCCCEEE | 20.11 | 26437602 | |
128 | Phosphorylation | IPNVVKYSPNCKLLI CCCCEEECCCCEEEE | 12.15 | - | |
131 | S-palmitoylation | VVKYSPNCKLLIVSN CEEECCCCEEEEECC | 3.59 | 29575903 | |
132 | Acetylation | VKYSPNCKLLIVSNP EEECCCCEEEEECCC | 53.63 | 21466224 | |
132 | Ubiquitination | VKYSPNCKLLIVSNP EEECCCCEEEEECCC | 53.63 | 21906983 | |
132 (in isoform 2) | Ubiquitination | - | 53.63 | 21890473 | |
137 | O-linked_Glycosylation | NCKLLIVSNPVDILT CCEEEEECCCHHHHH | 28.55 | 31373491 | |
144 | Phosphorylation | SNPVDILTYVAWKIS CCCHHHHHHHHHHCC | 19.11 | 28348404 | |
145 | Phosphorylation | NPVDILTYVAWKISG CCHHHHHHHHHHCCC | 5.68 | 25147952 | |
147 | Ubiquitination | VDILTYVAWKISGFP HHHHHHHHHHCCCCC | 7.45 | 21890473 | |
147 | Acetylation | VDILTYVAWKISGFP HHHHHHHHHHCCCCC | 7.45 | 19608861 | |
147 | Ubiquitination | VDILTYVAWKISGFP HHHHHHHHHHCCCCC | 7.45 | 19608861 | |
147 (in isoform 3) | Ubiquitination | - | 7.45 | - | |
149 | Acetylation | ILTYVAWKISGFPKN HHHHHHHHCCCCCCC | 19.77 | 21466224 | |
155 | Ubiquitination | WKISGFPKNRVIGSG HHCCCCCCCCEECCC | 55.94 | 21890473 | |
155 | Acetylation | WKISGFPKNRVIGSG HHCCCCCCCCEECCC | 55.94 | 19608861 | |
155 | Ubiquitination | WKISGFPKNRVIGSG HHCCCCCCCCEECCC | 55.94 | 21890473 | |
155 (in isoform 1) | Ubiquitination | - | 55.94 | 21890473 | |
155 (in isoform 2) | Ubiquitination | - | 55.94 | 21890473 | |
155 (in isoform 3) | Ubiquitination | - | 55.94 | - | |
157 | Methylation | ISGFPKNRVIGSGCN CCCCCCCCEECCCCC | 27.79 | - | |
161 | Phosphorylation | PKNRVIGSGCNLDSA CCCCEECCCCCCCHH | 29.11 | 24114839 | |
163 | S-palmitoylation | NRVIGSGCNLDSARF CCEECCCCCCCHHHH | 4.97 | 29575903 | |
164 | Acetylation | RVIGSGCNLDSARFR CEECCCCCCCHHHHH | 50.86 | 19608861 | |
164 | Ubiquitination | RVIGSGCNLDSARFR CEECCCCCCCHHHHH | 50.86 | 19608861 | |
167 | Phosphorylation | GSGCNLDSARFRYLM CCCCCCCHHHHHHHH | 25.22 | 21712546 | |
169 | Methylation | GCNLDSARFRYLMGE CCCCCHHHHHHHHCC | 22.11 | - | |
172 | Phosphorylation | LDSARFRYLMGERLG CCHHHHHHHHCCCCC | 9.79 | 25147952 | |
174 | Ubiquitination | SARFRYLMGERLGVH HHHHHHHHCCCCCCC | 3.77 | 21890473 | |
184 | Ubiquitination | RLGVHPLSCHGWVLG CCCCCEEECCCEEEC | 14.44 | 21890473 | |
184 | Phosphorylation | RLGVHPLSCHGWVLG CCCCCEEECCCEEEC | 14.44 | - | |
185 | Ubiquitination | LGVHPLSCHGWVLGE CCCCEEECCCEEECC | 4.54 | 21890473 | |
196 | Phosphorylation | VLGEHGDSSVPVWSG EECCCCCCCCCCCCC | 37.52 | 28348404 | |
197 | Phosphorylation | LGEHGDSSVPVWSGM ECCCCCCCCCCCCCC | 34.87 | 28348404 | |
204 | Sulfoxidation | SVPVWSGMNVAGVSL CCCCCCCCCCCCEEE | 2.81 | 30846556 | |
212 | Acetylation | NVAGVSLKTLHPDLG CCCCEEECCCCCCCC | 41.35 | 26051181 | |
212 | Ubiquitination | NVAGVSLKTLHPDLG CCCCEEECCCCCCCC | 41.35 | - | |
213 | Phosphorylation | VAGVSLKTLHPDLGT CCCEEECCCCCCCCC | 35.28 | 26437602 | |
220 | Ubiquitination | TLHPDLGTDKDKEQW CCCCCCCCCCCHHHH | 47.36 | 21890473 | |
220 | Acetylation | TLHPDLGTDKDKEQW CCCCCCCCCCCHHHH | 47.36 | 19608861 | |
220 | Ubiquitination | TLHPDLGTDKDKEQW CCCCCCCCCCCHHHH | 47.36 | 19608861 | |
222 | Acetylation | HPDLGTDKDKEQWKE CCCCCCCCCHHHHHH | 71.22 | 23954790 | |
222 | Ubiquitination | HPDLGTDKDKEQWKE CCCCCCCCCHHHHHH | 71.22 | 21906983 | |
222 (in isoform 2) | Ubiquitination | - | 71.22 | 21890473 | |
224 | Acetylation | DLGTDKDKEQWKEVH CCCCCCCHHHHHHHH | 58.51 | 23749302 | |
224 | Ubiquitination | DLGTDKDKEQWKEVH CCCCCCCHHHHHHHH | 58.51 | - | |
228 | Acetylation | DKDKEQWKEVHKQVV CCCHHHHHHHHHHHH | 49.94 | 22424773 | |
228 | Succinylation | DKDKEQWKEVHKQVV CCCHHHHHHHHHHHH | 49.94 | 23954790 | |
228 | Ubiquitination | DKDKEQWKEVHKQVV CCCHHHHHHHHHHHH | 49.94 | - | |
232 | Acetylation | EQWKEVHKQVVESAY HHHHHHHHHHHHHHH | 50.38 | 23954790 | |
232 | Malonylation | EQWKEVHKQVVESAY HHHHHHHHHHHHHHH | 50.38 | 26320211 | |
232 | Ubiquitination | EQWKEVHKQVVESAY HHHHHHHHHHHHHHH | 50.38 | 21890473 | |
232 (in isoform 1) | Ubiquitination | - | 50.38 | 21890473 | |
232 (in isoform 2) | Phosphorylation | - | 50.38 | 24719451 | |
233 (in isoform 2) | Phosphorylation | - | 29.61 | 24719451 | |
237 | Phosphorylation | VHKQVVESAYEVIKL HHHHHHHHHHHHHHH | 25.25 | 21945579 | |
239 | Phosphorylation | KQVVESAYEVIKLKG HHHHHHHHHHHHHCC | 21.73 | 25159151 | |
243 | Acetylation | ESAYEVIKLKGYTSW HHHHHHHHHCCCCHH | 49.69 | 23954790 | |
243 | Ubiquitination | ESAYEVIKLKGYTSW HHHHHHHHHCCCCHH | 49.69 | 21890473 | |
243 (in isoform 1) | Ubiquitination | - | 49.69 | 21890473 | |
245 | Ubiquitination | AYEVIKLKGYTSWAI HHHHHHHCCCCHHHH | 44.89 | - | |
247 | Phosphorylation | EVIKLKGYTSWAIGL HHHHHCCCCHHHHHC | 8.94 | 20068231 | |
248 | Phosphorylation | VIKLKGYTSWAIGLS HHHHCCCCHHHHHCC | 26.85 | 20068231 | |
249 | Phosphorylation | IKLKGYTSWAIGLSV HHHCCCCHHHHHCCH | 13.16 | 20068231 | |
251 | Acetylation | LKGYTSWAIGLSVAD HCCCCHHHHHCCHHH | 5.92 | 19608861 | |
251 | Ubiquitination | LKGYTSWAIGLSVAD HCCCCHHHHHCCHHH | 5.92 | 19608861 | |
251 (in isoform 3) | Ubiquitination | - | 5.92 | - | |
253 (in isoform 3) | Ubiquitination | - | 12.26 | - | |
255 | Phosphorylation | TSWAIGLSVADLAES CHHHHHCCHHHHHHH | 15.28 | 20068231 | |
260 | Acetylation | GLSVADLAESIMKNL HCCHHHHHHHHHHHH | 14.72 | 19608861 | |
260 | Ubiquitination | GLSVADLAESIMKNL HCCHHHHHHHHHHHH | 14.72 | 19608861 | |
261 | Ubiquitination | LSVADLAESIMKNLR CCHHHHHHHHHHHHC | 48.36 | 21890473 | |
261 (in isoform 3) | Ubiquitination | - | 48.36 | - | |
262 | Phosphorylation | SVADLAESIMKNLRR CHHHHHHHHHHHHCC | 23.52 | 20068231 | |
264 | Sulfoxidation | ADLAESIMKNLRRVH HHHHHHHHHHHCCCC | 3.07 | 30846556 | |
266 | Phosphorylation | LAESIMKNLRRVHPV HHHHHHHHHCCCCCH | 22.77 | 27251275 | |
268 | Phosphorylation | ESIMKNLRRVHPVST HHHHHHHCCCCCHHH | 48.22 | 27642862 | |
269 | Methylation | SIMKNLRRVHPVSTM HHHHHHCCCCCHHHH | 33.97 | 115481941 | |
270 | Ubiquitination | IMKNLRRVHPVSTMI HHHHHCCCCCHHHHH | 4.90 | 21890473 | |
272 | Ubiquitination | KNLRRVHPVSTMIKG HHHCCCCCHHHHHHH | 20.92 | 21890473 | |
272 (in isoform 3) | Ubiquitination | - | 20.92 | - | |
274 | Phosphorylation | LRRVHPVSTMIKGLY HCCCCCHHHHHHHHH | 19.40 | 29802988 | |
274 (in isoform 3) | Ubiquitination | - | 19.40 | - | |
275 | Phosphorylation | RRVHPVSTMIKGLYG CCCCCHHHHHHHHHC | 24.13 | 29802988 | |
276 | Sulfoxidation | RVHPVSTMIKGLYGI CCCCHHHHHHHHHCC | 2.02 | 30846556 | |
278 | Acetylation | HPVSTMIKGLYGIKD CCHHHHHHHHHCCCC | 31.85 | 23954790 | |
278 | Malonylation | HPVSTMIKGLYGIKD CCHHHHHHHHHCCCC | 31.85 | 26320211 | |
278 | Methylation | HPVSTMIKGLYGIKD CCHHHHHHHHHCCCC | 31.85 | 22639955 | |
278 | Ubiquitination | HPVSTMIKGLYGIKD CCHHHHHHHHHCCCC | 31.85 | 21890473 | |
278 (in isoform 1) | Ubiquitination | - | 31.85 | 21890473 | |
284 | Succinylation | IKGLYGIKDDVFLSV HHHHHCCCCCEEEEC | 43.44 | 23954790 | |
284 | Ubiquitination | IKGLYGIKDDVFLSV HHHHHCCCCCEEEEC | 43.44 | - | |
284 (in isoform 2) | Ubiquitination | - | 43.44 | 21890473 | |
305 | Ubiquitination | NGISDLVKVTLTSEE CCCCCCEEEECCCHH | 36.48 | - | |
307 | Ubiquitination | ISDLVKVTLTSEEEA CCCCEEEECCCHHHH | 20.71 | 21890473 | |
307 | Acetylation | ISDLVKVTLTSEEEA CCCCEEEECCCHHHH | 20.71 | 19608861 | |
307 | Phosphorylation | ISDLVKVTLTSEEEA CCCCEEEECCCHHHH | 20.71 | 21815630 | |
307 | Ubiquitination | ISDLVKVTLTSEEEA CCCCEEEECCCHHHH | 20.71 | 19608861 | |
307 (in isoform 3) | Ubiquitination | - | 20.71 | - | |
309 | Phosphorylation | DLVKVTLTSEEEARL CCEEEECCCHHHHHH | 25.40 | 29255136 | |
310 | Phosphorylation | LVKVTLTSEEEARLK CEEEECCCHHHHHHH | 46.23 | 29255136 | |
317 | Ubiquitination | SEEEARLKKSADTLW CHHHHHHHHHHHHHH | 38.85 | - | |
318 | Acetylation | EEEARLKKSADTLWG HHHHHHHHHHHHHHH | 56.31 | 19608861 | |
318 | Malonylation | EEEARLKKSADTLWG HHHHHHHHHHHHHHH | 56.31 | 26320211 | |
318 | Succinylation | EEEARLKKSADTLWG HHHHHHHHHHHHHHH | 56.31 | - | |
318 | Succinylation | EEEARLKKSADTLWG HHHHHHHHHHHHHHH | 56.31 | - | |
318 | Ubiquitination | EEEARLKKSADTLWG HHHHHHHHHHHHHHH | 56.31 | 19608861 | |
318 (in isoform 2) | Ubiquitination | - | 56.31 | 21890473 | |
319 | Phosphorylation | EEARLKKSADTLWGI HHHHHHHHHHHHHHH | 29.77 | 22777824 | |
322 | Phosphorylation | RLKKSADTLWGIQKE HHHHHHHHHHHHHHH | 24.91 | 20873877 | |
328 | Acetylation | DTLWGIQKELQF--- HHHHHHHHHHCC--- | 59.48 | 22424773 | |
328 | Succinylation | DTLWGIQKELQF--- HHHHHHHHHHCC--- | 59.48 | 23954790 | |
328 | Sumoylation | DTLWGIQKELQF--- HHHHHHHHHHCC--- | 59.48 | - | |
328 | Ubiquitination | DTLWGIQKELQF--- HHHHHHHHHHCC--- | 59.48 | 21890473 | |
328 (in isoform 1) | Ubiquitination | - | 59.48 | 21890473 | |
328 (in isoform 2) | Ubiquitination | - | 59.48 | 21890473 | |
338 | Phosphorylation | QF------------- CC------------- | 27251275 | ||
346 (in isoform 3) | Ubiquitination | - | - | ||
347 | Acetylation | ---------------------- ---------------------- | 19608861 | ||
347 | Ubiquitination | ---------------------- ---------------------- | 19608861 | ||
347 (in isoform 3) | Ubiquitination | - | - | ||
357 | Ubiquitination | -------------------------------- -------------------------------- | 21890473 | ||
357 (in isoform 3) | Ubiquitination | - | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
3 | T | Phosphorylation | Kinase | MAP3K7 | O43318 | GPS |
10 | Y | Phosphorylation | Kinase | ERBB2 | P04626 | GPS |
10 | Y | Phosphorylation | Kinase | FGFR1 | P11362 | PSP |
10 | Y | Phosphorylation | Kinase | SRC | P12931 | PSP |
83 | Y | Phosphorylation | Kinase | FGFR1 | P11362 | PSP |
248 | T | Phosphorylation | Kinase | CDK1 | P06493 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LDHA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LDHA_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
612933 | Glycogen storage disease 11 (GSD11) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-5; LYS-14; LYS-57; LYS-81;LYS-118; LYS-126; LYS-222; LYS-278 AND LYS-318, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-10 AND TYR-239, AND MASSSPECTROMETRY. | |
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer."; Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.; Cell 131:1190-1203(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-239, AND MASSSPECTROMETRY. | |
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells."; Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.; Nat. Biotechnol. 23:94-101(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-239, AND MASSSPECTROMETRY. |