UniProt ID | NDKB_HUMAN | |
---|---|---|
UniProt AC | P22392 | |
Protein Name | Nucleoside diphosphate kinase B | |
Gene Name | NME2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 152 | |
Subcellular Localization | Cytoplasm . Nucleus . Cell projection, lamellipodium . Cell projection, ruffle . Isoform 3 is mainly cytoplasmic and isoform 1 and isoform 3 are excluded from the nucleolus. Colocalizes with ITGB1 and ITGB1BP1 at the edge or peripheral ruffles and la | |
Protein Description | Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically. [PubMed: 8392752 Exhibits histidine protein kinase activity.] | |
Protein Sequence | MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MANLERTFI ------CCCCEEEEE | 29.34 | - | |
6 | Methylation | --MANLERTFIAIKP --CCCCEEEEEEECC | 37.79 | 115485165 | |
7 | Phosphorylation | -MANLERTFIAIKPD -CCCCEEEEEEECCC | 15.26 | 30624053 | |
12 | Acetylation | ERTFIAIKPDGVQRG EEEEEEECCCCHHHC | 28.21 | 22638521 | |
12 | Ubiquitination | ERTFIAIKPDGVQRG EEEEEEECCCCHHHC | 28.21 | 27667366 | |
12 (in isoform 2) | Ubiquitination | - | 28.21 | 21890473 | |
12 (in isoform 1) | Ubiquitination | - | 28.21 | 21890473 | |
18 | Methylation | IKPDGVQRGLVGEII ECCCCHHHCHHHHHH | 37.70 | - | |
26 | Acetylation | GLVGEIIKRFEQKGF CHHHHHHHHHHHCCH | 57.61 | 8275725 | |
26 | Ubiquitination | GLVGEIIKRFEQKGF CHHHHHHHHHHHCCH | 57.61 | 23000965 | |
26 | Neddylation | GLVGEIIKRFEQKGF CHHHHHHHHHHHCCH | 57.61 | 32015554 | |
26 (in isoform 2) | Ubiquitination | - | 57.61 | 21890473 | |
26 (in isoform 1) | Ubiquitination | - | 57.61 | 21890473 | |
31 | Acetylation | IIKRFEQKGFRLVAM HHHHHHHCCHHHHHH | 53.47 | 129823 | |
31 | Ubiquitination | IIKRFEQKGFRLVAM HHHHHHHCCHHHHHH | 53.47 | 23000965 | |
31 | Neddylation | IIKRFEQKGFRLVAM HHHHHHHCCHHHHHH | 53.47 | 32015554 | |
39 | Acetylation | GFRLVAMKFLRASEE CHHHHHHHHHHHCHH | 31.35 | 25825284 | |
39 | Ubiquitination | GFRLVAMKFLRASEE CHHHHHHHHHHHCHH | 31.35 | 23000965 | |
39 (in isoform 2) | Ubiquitination | - | 31.35 | 21890473 | |
39 (in isoform 1) | Ubiquitination | - | 31.35 | 21890473 | |
42 | Methylation | LVAMKFLRASEEHLK HHHHHHHHHCHHHHH | 38.92 | 115485181 | |
44 | Phosphorylation | AMKFLRASEEHLKQH HHHHHHHCHHHHHHH | 36.76 | 22617229 | |
49 | Acetylation | RASEEHLKQHYIDLK HHCHHHHHHHCCCCC | 36.62 | 23954790 | |
49 | Ubiquitination | RASEEHLKQHYIDLK HHCHHHHHHHCCCCC | 36.62 | 23000965 | |
49 (in isoform 2) | Ubiquitination | - | 36.62 | 21890473 | |
49 (in isoform 1) | Ubiquitination | - | 36.62 | 21890473 | |
52 | Phosphorylation | EEHLKQHYIDLKDRP HHHHHHHCCCCCCCC | 8.14 | 28152594 | |
56 | Acetylation | KQHYIDLKDRPFFPG HHHCCCCCCCCCCCC | 48.20 | 22638529 | |
56 | Ubiquitination | KQHYIDLKDRPFFPG HHHCCCCCCCCCCCC | 48.20 | 23000965 | |
56 | Neddylation | KQHYIDLKDRPFFPG HHHCCCCCCCCCCCC | 48.20 | 32015554 | |
56 (in isoform 2) | Ubiquitination | - | 48.20 | 21890473 | |
56 (in isoform 1) | Ubiquitination | - | 48.20 | 21890473 | |
58 | Methylation | HYIDLKDRPFFPGLV HCCCCCCCCCCCCHH | 28.47 | 115485173 | |
66 | Acetylation | PFFPGLVKYMNSGPV CCCCCHHHHCCCCCE | 43.77 | 30585623 | |
66 | Ubiquitination | PFFPGLVKYMNSGPV CCCCCHHHHCCCCCE | 43.77 | - | |
67 | Phosphorylation | FFPGLVKYMNSGPVV CCCCHHHHCCCCCEE | 8.27 | 26330541 | |
85 | Acetylation | WEGLNVVKTGRVMLG ECCCCEEEECCEEEC | 40.76 | 19608861 | |
85 | Ubiquitination | WEGLNVVKTGRVMLG ECCCCEEEECCEEEC | 40.76 | 22817900 | |
85 (in isoform 2) | Ubiquitination | - | 40.76 | 21890473 | |
85 (in isoform 1) | Ubiquitination | - | 40.76 | 21890473 | |
88 | Methylation | LNVVKTGRVMLGETN CCEEEECCEEECCCC | 18.86 | - | |
90 | Sulfoxidation | VVKTGRVMLGETNPA EEEECCEEECCCCCC | 3.71 | 30846556 | |
94 | Phosphorylation | GRVMLGETNPADSKP CCEEECCCCCCCCCC | 44.71 | 29255136 | |
99 | Phosphorylation | GETNPADSKPGTIRG CCCCCCCCCCCCCCC | 42.74 | 30266825 | |
100 | Methylation | ETNPADSKPGTIRGD CCCCCCCCCCCCCCC | 48.27 | 7618957 | |
100 | Acetylation | ETNPADSKPGTIRGD CCCCCCCCCCCCCCC | 48.27 | 7618957 | |
100 | Ubiquitination | ETNPADSKPGTIRGD CCCCCCCCCCCCCCC | 48.27 | 27667366 | |
100 | Sumoylation | ETNPADSKPGTIRGD CCCCCCCCCCCCCCC | 48.27 | - | |
100 | Neddylation | ETNPADSKPGTIRGD CCCCCCCCCCCCCCC | 48.27 | 32015554 | |
100 (in isoform 2) | Ubiquitination | - | 48.27 | 21890473 | |
100 (in isoform 1) | Ubiquitination | - | 48.27 | 21890473 | |
103 | Phosphorylation | PADSKPGTIRGDFCI CCCCCCCCCCCCEEE | 18.94 | 23927012 | |
109 | S-palmitoylation | GTIRGDFCIQVGRNI CCCCCCEEEEECCCE | 2.24 | 29575903 | |
114 | Methylation | DFCIQVGRNIIHGSD CEEEEECCCEEECCC | 32.11 | 115485189 | |
118 | Phosphorylation | QVGRNIIHGSDSVKS EECCCEEECCCHHHC | 26.38 | - | |
120 | Phosphorylation | GRNIIHGSDSVKSAE CCCEEECCCHHHCCH | 16.73 | 29255136 | |
122 | Phosphorylation | NIIHGSDSVKSAEKE CEEECCCHHHCCHHE | 32.89 | 29255136 | |
124 | Acetylation | IHGSDSVKSAEKEIS EECCCHHHCCHHEEE | 48.15 | 22638497 | |
124 | Ubiquitination | IHGSDSVKSAEKEIS EECCCHHHCCHHEEE | 48.15 | 23000965 | |
124 | Sumoylation | IHGSDSVKSAEKEIS EECCCHHHCCHHEEE | 48.15 | - | |
124 | Neddylation | IHGSDSVKSAEKEIS EECCCHHHCCHHEEE | 48.15 | 32015554 | |
124 (in isoform 1) | Ubiquitination | - | 48.15 | 21890473 | |
125 | Phosphorylation | HGSDSVKSAEKEISL ECCCHHHCCHHEEEC | 39.23 | 26330541 | |
127 | Ubiquitination | SDSVKSAEKEISLWF CCHHHCCHHEEECEE | 59.31 | 23000965 | |
128 | Acetylation | DSVKSAEKEISLWFK CHHHCCHHEEECEEC | 61.13 | 23954790 | |
128 | Ubiquitination | DSVKSAEKEISLWFK CHHHCCHHEEECEEC | 61.13 | 23000965 | |
128 (in isoform 1) | Ubiquitination | - | 61.13 | 21890473 | |
131 | Phosphorylation | KSAEKEISLWFKPEE HCCHHEEECEECHHH | 22.19 | - | |
135 | Ubiquitination | KEISLWFKPEELVDY HEEECEECHHHHCCC | 39.68 | 21906983 | |
135 | Acetylation | KEISLWFKPEELVDY HEEECEECHHHHCCC | 39.68 | 26822725 | |
135 (in isoform 1) | Ubiquitination | - | 39.68 | 21890473 | |
141 | Acetylation | FKPEELVDYKSCAHD ECHHHHCCCCCCCCC | 58.74 | - | |
141 | Ubiquitination | FKPEELVDYKSCAHD ECHHHHCCCCCCCCC | 58.74 | 23000965 | |
141 | Neddylation | FKPEELVDYKSCAHD ECHHHHCCCCCCCCC | 58.74 | 32015554 | |
142 | Phosphorylation | KPEELVDYKSCAHDW CHHHHCCCCCCCCCC | 9.42 | - | |
143 | Acetylation | PEELVDYKSCAHDWV HHHHCCCCCCCCCCC | 34.30 | 70615 | |
143 | Ubiquitination | PEELVDYKSCAHDWV HHHHCCCCCCCCCCC | 34.30 | 29967540 | |
144 | Phosphorylation | EELVDYKSCAHDWVY HHHCCCCCCCCCCCC | 15.42 | 27134283 | |
145 | Glutathionylation | ELVDYKSCAHDWVYE HHCCCCCCCCCCCCC | 3.22 | 22555962 | |
145 | S-palmitoylation | ELVDYKSCAHDWVYE HHCCCCCCCCCCCCC | 3.22 | 29575903 | |
146 | Ubiquitination | LVDYKSCAHDWVYE- HCCCCCCCCCCCCC- | 15.68 | 23000965 | |
146 | Neddylation | LVDYKSCAHDWVYE- HCCCCCCCCCCCCC- | 15.68 | 32015554 | |
151 | Phosphorylation | SCAHDWVYE------ CCCCCCCCC------ | 16.21 | 26356563 | |
154 | Ubiquitination | HDWVYE--------- CCCCCC--------- | 21890473 | ||
154 (in isoform 2) | Ubiquitination | - | 21890473 | ||
159 | Phosphorylation | E-------------- C-------------- | 8245015 | ||
164 | Acetylation | ------------------- ------------------- | 19608861 | ||
164 | Ubiquitination | ------------------- ------------------- | 23000965 | ||
164 (in isoform 2) | Ubiquitination | - | 21890473 | ||
171 | Acetylation | -------------------------- -------------------------- | 19608861 | ||
171 | Ubiquitination | -------------------------- -------------------------- | 23000965 | ||
171 | Neddylation | -------------------------- -------------------------- | 32015554 | ||
171 (in isoform 2) | Ubiquitination | - | 21890473 | ||
181 | Acetylation | ------------------------------------ ------------------------------------ | - | ||
181 | Ubiquitination | ------------------------------------ ------------------------------------ | - | ||
200 | Acetylation | ------------------------------------------------------- ------------------------------------------------------- | 19608861 | ||
200 | Ubiquitination | ------------------------------------------------------- ------------------------------------------------------- | 22817900 | ||
200 (in isoform 2) | Ubiquitination | - | - | ||
209 | Phosphorylation | ---------------------------------------------------------------- ---------------------------------------------------------------- | 32645325 | ||
214 | Phosphorylation | --------------------------------------------------------------------- --------------------------------------------------------------------- | - | ||
215 | Methylation | ---------------------------------------------------------------------- ---------------------------------------------------------------------- | - | ||
215 | Acetylation | ---------------------------------------------------------------------- ---------------------------------------------------------------------- | - | ||
215 | Ubiquitination | ---------------------------------------------------------------------- ---------------------------------------------------------------------- | 23000965 | ||
215 | Neddylation | ---------------------------------------------------------------------- ---------------------------------------------------------------------- | 32015554 | ||
218 | Phosphorylation | ------------------------------------------------------------------------- ------------------------------------------------------------------------- | - | ||
233 | Phosphorylation | ---------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------- | 1851158 | ||
235 | Phosphorylation | ------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------ | 20068231 | ||
237 | Phosphorylation | -------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------- | 20068231 | ||
239 | Acetylation | ---------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------- | 19608861 | ||
239 | Ubiquitination | ---------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------- | 23000965 | ||
239 | Neddylation | ---------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------- | 32015554 | ||
239 (in isoform 2) | Ubiquitination | - | 21890473 | ||
243 | Acetylation | -------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------- | 19608861 | ||
243 | Ubiquitination | -------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------- | 23000965 | ||
243 (in isoform 2) | Ubiquitination | - | 21890473 | ||
250 | Ubiquitination | --------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------- | 32015554 | ||
250 (in isoform 2) | Ubiquitination | - | 21890473 | ||
258 | Ubiquitination | ----------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------- | 29967540 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDKB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDKB_HUMAN !! |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00718 | Adefovir Dipivoxil |
DB00709 | Lamivudine |
DB00300 | Tenofovir |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-12; LYS-49; LYS-56; LYS-85;LYS-100; LYS-124 AND LYS-128, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells."; Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.; J. Proteome Res. 8:3852-3861(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-52, AND MASSSPECTROMETRY. |