UniProt ID | FKBP2_HUMAN | |
---|---|---|
UniProt AC | P26885 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP2 | |
Gene Name | FKBP2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 142 | |
Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein . |
|
Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.. | |
Protein Sequence | MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | ICLSAVATATGAEGK HHHHHHHHHHCCCCC | 20.39 | - | |
23 | Phosphorylation | LSAVATATGAEGKRK HHHHHHHHCCCCCCE | 32.35 | - | |
56 | Phosphorylation | GDVLHMHYTGKLEDG CCEEEEEECCCCCCC | 15.04 | - | |
57 | Phosphorylation | DVLHMHYTGKLEDGT CEEEEEECCCCCCCC | 17.11 | - | |
96 | Sulfoxidation | WDQGLLGMCEGEKRK CCHHHHCCCCCCCEE | 1.57 | 30846556 | |
97 | Glutathionylation | DQGLLGMCEGEKRKL CHHHHCCCCCCCEEE | 6.04 | 22555962 | |
101 | Acetylation | LGMCEGEKRKLVIPS HCCCCCCCEEEEECH | 66.73 | 30588803 | |
101 | 2-Hydroxyisobutyrylation | LGMCEGEKRKLVIPS HCCCCCCCEEEEECH | 66.73 | - | |
108 | Phosphorylation | KRKLVIPSELGYGER CEEEEECHHCCCCCC | 34.04 | 28152594 | |
112 | Phosphorylation | VIPSELGYGERGAPP EECHHCCCCCCCCCC | 28.56 | 28152594 | |
115 | Methylation | SELGYGERGAPPKIP HHCCCCCCCCCCCCC | 42.06 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKBP2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKBP2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKBP2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...