| UniProt ID | FKBP2_HUMAN | |
|---|---|---|
| UniProt AC | P26885 | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP2 | |
| Gene Name | FKBP2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 142 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein . |
|
| Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.. | |
| Protein Sequence | MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Phosphorylation | ICLSAVATATGAEGK HHHHHHHHHHCCCCC | 20.39 | - | |
| 23 | Phosphorylation | LSAVATATGAEGKRK HHHHHHHHCCCCCCE | 32.35 | - | |
| 56 | Phosphorylation | GDVLHMHYTGKLEDG CCEEEEEECCCCCCC | 15.04 | - | |
| 57 | Phosphorylation | DVLHMHYTGKLEDGT CEEEEEECCCCCCCC | 17.11 | - | |
| 96 | Sulfoxidation | WDQGLLGMCEGEKRK CCHHHHCCCCCCCEE | 1.57 | 30846556 | |
| 97 | Glutathionylation | DQGLLGMCEGEKRKL CHHHHCCCCCCCEEE | 6.04 | 22555962 | |
| 101 | Acetylation | LGMCEGEKRKLVIPS HCCCCCCCEEEEECH | 66.73 | 30588803 | |
| 101 | 2-Hydroxyisobutyrylation | LGMCEGEKRKLVIPS HCCCCCCCEEEEECH | 66.73 | - | |
| 108 | Phosphorylation | KRKLVIPSELGYGER CEEEEECHHCCCCCC | 34.04 | 28152594 | |
| 112 | Phosphorylation | VIPSELGYGERGAPP EECHHCCCCCCCCCC | 28.56 | 28152594 | |
| 115 | Methylation | SELGYGERGAPPKIP HHCCCCCCCCCCCCC | 42.06 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKBP2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKBP2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKBP2_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
