| UniProt ID | FKB1A_HUMAN | |
|---|---|---|
| UniProt AC | P62942 | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP1A | |
| Gene Name | FKBP1A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 108 | |
| Subcellular Localization |
Cytoplasm, cytosol . Sarcoplasmic reticulum membrane Peripheral membrane protein Cytoplasmic side . |
|
| Protein Description | Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.. | |
| Protein Sequence | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MGVQVETISPGDGR -CCCEEEEECCCCCC | 28.09 | 30266825 | |
| 9 | Phosphorylation | GVQVETISPGDGRTF CCEEEEECCCCCCCC | 30.19 | 23401153 | |
| 15 | Phosphorylation | ISPGDGRTFPKRGQT ECCCCCCCCCCCCCE | 50.23 | 29514088 | |
| 19 | Methylation | DGRTFPKRGQTCVVH CCCCCCCCCCEEEEE | 42.56 | - | |
| 22 | Phosphorylation | TFPKRGQTCVVHYTG CCCCCCCEEEEEEEE | 15.30 | 23312004 | |
| 23 | Glutathionylation | FPKRGQTCVVHYTGM CCCCCCEEEEEEEEE | 2.01 | 22555962 | |
| 30 | Sulfoxidation | CVVHYTGMLEDGKKF EEEEEEEEECCCCCC | 2.60 | 30846556 | |
| 35 | Acetylation | TGMLEDGKKFDSSRD EEEECCCCCCCCCCC | 63.69 | 25953088 | |
| 35 | Ubiquitination | TGMLEDGKKFDSSRD EEEECCCCCCCCCCC | 63.69 | - | |
| 36 | Acetylation | GMLEDGKKFDSSRDR EEECCCCCCCCCCCC | 60.99 | 155799 | |
| 36 | Ubiquitination | GMLEDGKKFDSSRDR EEECCCCCCCCCCCC | 60.99 | - | |
| 48 | Malonylation | RDRNKPFKFMLGKQE CCCCCCEEEEECCHH | 38.09 | 26320211 | |
| 48 | Acetylation | RDRNKPFKFMLGKQE CCCCCCEEEEECCHH | 38.09 | 23749302 | |
| 48 | Ubiquitination | RDRNKPFKFMLGKQE CCCCCCEEEEECCHH | 38.09 | - | |
| 53 | Malonylation | PFKFMLGKQEVIRGW CEEEEECCHHHHCCH | 39.05 | 26320211 | |
| 53 | Succinylation | PFKFMLGKQEVIRGW CEEEEECCHHHHCCH | 39.05 | - | |
| 53 | Succinylation | PFKFMLGKQEVIRGW CEEEEECCHHHHCCH | 39.05 | - | |
| 53 | Acetylation | PFKFMLGKQEVIRGW CEEEEECCHHHHCCH | 39.05 | 23954790 | |
| 53 | Ubiquitination | PFKFMLGKQEVIRGW CEEEEECCHHHHCCH | 39.05 | 2189047 | |
| 58 | Methylation | LGKQEVIRGWEEGVA ECCHHHHCCHHHHCE | 49.72 | - | |
| 67 | Sulfoxidation | WEEGVAQMSVGQRAK HHHHCEEEECCCCEE | 2.24 | 30846556 | |
| 74 | Ubiquitination | MSVGQRAKLTISPDY EECCCCEEEEECCCC | 48.64 | - | |
| 81 | Phosphorylation | KLTISPDYAYGATGH EEEECCCCCCCCCCC | 12.71 | 25884760 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKB1A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKB1A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKB1A_HUMAN !! | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-53, AND MASS SPECTROMETRY. | |
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-9, AND MASSSPECTROMETRY. | |