| UniProt ID | RAB3C_HUMAN | |
|---|---|---|
| UniProt AC | Q96E17 | |
| Protein Name | Ras-related protein Rab-3C | |
| Gene Name | RAB3C | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 227 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | Protein transport. Probably involved in vesicular traffic (By similarity).. | |
| Protein Sequence | MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | ASAQDARYGQKDSSD HHHHHHHCCCCCCCC | 26.15 | 21951684 | |
| 22 | Phosphorylation | ARYGQKDSSDQNFDY HHCCCCCCCCCCHHH | 42.73 | - | |
| 23 | Phosphorylation | RYGQKDSSDQNFDYM HCCCCCCCCCCHHHE | 54.04 | - | |
| 29 | Phosphorylation | SSDQNFDYMFKLLII CCCCCHHHEEEEEEE | 10.58 | 21951684 | |
| 44 | Phosphorylation | GNSSVGKTSFLFRYA CCCCCCCEEEEEEEC | 20.84 | 23879269 | |
| 45 | Phosphorylation | NSSVGKTSFLFRYAD CCCCCCEEEEEEECC | 24.36 | 23879269 | |
| 50 | Phosphorylation | KTSFLFRYADDSFTS CEEEEEEECCCCHHH | 13.67 | 23879269 | |
| 54 | Phosphorylation | LFRYADDSFTSAFVS EEEECCCCHHHHHHH | 30.85 | 22817900 | |
| 86 | Phosphorylation | IKLQIWDTAGQERYR EEEEEEECCCHHHHH | 20.07 | 28857561 | |
| 92 | Phosphorylation | DTAGQERYRTITTAY ECCCHHHHHHHHHHH | 16.03 | 19060867 | |
| 94 | Phosphorylation | AGQERYRTITTAYYR CCHHHHHHHHHHHHH | 17.46 | 29125462 | |
| 96 | Phosphorylation | QERYRTITTAYYRGA HHHHHHHHHHHHHCC | 12.54 | - | |
| 97 | Phosphorylation | ERYRTITTAYYRGAM HHHHHHHHHHHHCCC | 14.60 | 24961811 | |
| 99 | Phosphorylation | YRTITTAYYRGAMGF HHHHHHHHHHCCCEE | 7.51 | 21951684 | |
| 100 | Phosphorylation | RTITTAYYRGAMGFI HHHHHHHHHCCCEEE | 10.50 | 21951684 | |
| 110 | Phosphorylation | AMGFILMYDITNEES CCEEEEEEECCCHHH | 10.76 | 21951684 | |
| 131 | Phosphorylation | WSTQIKTYSWDNAQV CCCEEEEEECCCCEE | 11.63 | 21951684 | |
| 179 | Ubiquitination | TSAKDNINVKQTFER CCCCCCCCHHHHHHH | 40.98 | 32142685 | |
| 181 | Ubiquitination | AKDNINVKQTFERLV CCCCCCHHHHHHHHH | 38.85 | 32142685 | |
| 196 | Phosphorylation | DIICDKMSESLETDP HHHHHHCCHHCCCCH | 29.76 | 24114839 | |
| 198 | Phosphorylation | ICDKMSESLETDPAI HHHHCCHHCCCCHHH | 24.97 | 27732954 | |
| 201 | Phosphorylation | KMSESLETDPAITAA HCCHHCCCCHHHHHH | 53.21 | 29449344 | |
| 206 | Phosphorylation | LETDPAITAAKQNTR CCCCHHHHHHHHCCC | 23.75 | 24114839 | |
| 209 | Ubiquitination | DPAITAAKQNTRLKE CHHHHHHHHCCCCCC | 41.43 | - | |
| 212 | Phosphorylation | ITAAKQNTRLKETPP HHHHHHCCCCCCCCC | 34.58 | 24114839 | |
| 225 | Geranylgeranylation | PPPPQPNCAC----- CCCCCCCCCC----- | 5.35 | - | |
| 227 | Methylation | PPQPNCAC------- CCCCCCCC------- | 6.63 | - | |
| 227 | Geranylgeranylation | PPQPNCAC------- CCCCCCCC------- | 6.63 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 94 | T | Phosphorylation | Kinase | LRRK2 | Q5S007 | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 94 | T | Phosphorylation |
| 29125462 |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB3C_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RAB3C_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...