NR2CA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NR2CA_HUMAN
• UniProt AC: Q86WQ0
• Protein Name: Nuclear receptor 2C2-associated protein
• Gene Name: NR2C2AP
• Organism: Homo sapiens (Human).
• Sequence Length: 139
• Subcellular Localization: Nucleus .
• Protein Description: May act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes..
• Protein Sequence: MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTHSLVCPE ------CCCCCCCHH	21.85	27486199
4	Phosphorylation	----MTHSLVCPETV ----CCCCCCCHHHH	17.21	28857561
16	Phosphorylation	ETVSRVSSVLNRNTR HHHHHHHHHHCCCCC	27.97	28857561
22	Phosphorylation	SSVLNRNTRQFGKKH HHHHCCCCCHHCHHC	23.70	27251275
74	Methylation	QGGFSSRRGCLEGSQ CCCCCCCCCCCCCCH	41.97	115485519

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NR2CA_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NR2CA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NR2CA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NR2C2_HUMAN	NR2C2	physical	12486131

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.