UniProt ID | NR2CA_HUMAN | |
---|---|---|
UniProt AC | Q86WQ0 | |
Protein Name | Nuclear receptor 2C2-associated protein | |
Gene Name | NR2C2AP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 139 | |
Subcellular Localization | Nucleus . | |
Protein Description | May act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.. | |
Protein Sequence | MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTHSLVCPE ------CCCCCCCHH | 21.85 | 27486199 | |
4 | Phosphorylation | ----MTHSLVCPETV ----CCCCCCCHHHH | 17.21 | 28857561 | |
16 | Phosphorylation | ETVSRVSSVLNRNTR HHHHHHHHHHCCCCC | 27.97 | 28857561 | |
22 | Phosphorylation | SSVLNRNTRQFGKKH HHHHCCCCCHHCHHC | 23.70 | 27251275 | |
74 | Methylation | QGGFSSRRGCLEGSQ CCCCCCCCCCCCCCH | 41.97 | 115485519 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NR2CA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NR2CA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NR2CA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NR2C2_HUMAN | NR2C2 | physical | 12486131 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...