NTF2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NTF2_HUMAN
• UniProt AC: P61970
• Protein Name: Nuclear transport factor 2 {ECO:0000303|PubMed:7744965}
• Gene Name: NUTF2 {ECO:0000312|HGNC:HGNC:13722}
• Organism: Homo sapiens (Human).
• Sequence Length: 127
• Subcellular Localization: Cytoplasm, cytosol . Nucleus outer membrane . Nucleus, nuclear pore complex . Nucleus inner membrane . Nucleus, nucleoplasm . At steady state it is essentially nucleoplasmic, enriched in nucleoplasmic foci.
• Protein Description: Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import..
• Protein Sequence: MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Acetylation	----MGDKPIWEQIG ----CCCCCHHHHHH	32.45	19608861
55	Ubiquitination	GKAAIVEKLSSLPFQ CCHHHHHHHHCCCHH	42.65	21906983
57	Phosphorylation	AAIVEKLSSLPFQKI HHHHHHHHCCCHHHC	40.68	30622161
58	Phosphorylation	AIVEKLSSLPFQKIQ HHHHHHHCCCHHHCE	50.96	30622161
63	Ubiquitination	LSSLPFQKIQHSITA HHCCCHHHCEEEECC	44.72	-
79	Phosphorylation	DHQPTPDSCIISMVV CCCCCCCCEEEEEEE	14.39	27251275
84	Sulfoxidation	PDSCIISMVVGQLKA CCCEEEEEEEECCCC	1.67	30846556

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NTF2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NTF2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NTF2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NU153_HUMAN	NUP153	physical	15522285
RAN_HUMAN	RAN	physical	15522285
LC7L2_HUMAN	LUC7L2	physical	16169070
NTF2_HUMAN	NUTF2	physical	7744965
RAN_HUMAN	RAN	physical	10228171
RAN_HUMAN	RAN	physical	22939629
NTF2_HUMAN	NUTF2	physical	25416956
NUP62_HUMAN	NUP62	physical	25416956
NUP62_HUMAN	NUP62	physical	16730000
AP2A1_HUMAN	AP2A1	physical	26344197
AP2A2_HUMAN	AP2A2	physical	26344197
NNRE_HUMAN	APOA1BP	physical	26344197
CGL_HUMAN	CTH	physical	26344197
GPX4_HUMAN	GPX4	physical	26344197
HINT1_HUMAN	HINT1	physical	26344197
PCP_HUMAN	PRCP	physical	26344197
RAB7A_HUMAN	RAB7A	physical	26344197
RHOA_HUMAN	RHOA	physical	26344197
TNG2_HUMAN	TANGO2	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Acetylation

"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-4, AND MASS SPECTROMETRY.
PubMed: 19608861