UniProt ID | NTF2_HUMAN | |
---|---|---|
UniProt AC | P61970 | |
Protein Name | Nuclear transport factor 2 {ECO:0000303|PubMed:7744965} | |
Gene Name | NUTF2 {ECO:0000312|HGNC:HGNC:13722} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 127 | |
Subcellular Localization | Cytoplasm, cytosol . Nucleus outer membrane . Nucleus, nuclear pore complex . Nucleus inner membrane . Nucleus, nucleoplasm . At steady state it is essentially nucleoplasmic, enriched in nucleoplasmic foci. | |
Protein Description | Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.. | |
Protein Sequence | MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Acetylation | ----MGDKPIWEQIG ----CCCCCHHHHHH | 32.45 | 19608861 | |
55 | Ubiquitination | GKAAIVEKLSSLPFQ CCHHHHHHHHCCCHH | 42.65 | 21906983 | |
57 | Phosphorylation | AAIVEKLSSLPFQKI HHHHHHHHCCCHHHC | 40.68 | 30622161 | |
58 | Phosphorylation | AIVEKLSSLPFQKIQ HHHHHHHCCCHHHCE | 50.96 | 30622161 | |
63 | Ubiquitination | LSSLPFQKIQHSITA HHCCCHHHCEEEECC | 44.72 | - | |
79 | Phosphorylation | DHQPTPDSCIISMVV CCCCCCCCEEEEEEE | 14.39 | 27251275 | |
84 | Sulfoxidation | PDSCIISMVVGQLKA CCCEEEEEEEECCCC | 1.67 | 30846556 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NTF2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NTF2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NTF2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NU153_HUMAN | NUP153 | physical | 15522285 | |
RAN_HUMAN | RAN | physical | 15522285 | |
LC7L2_HUMAN | LUC7L2 | physical | 16169070 | |
NTF2_HUMAN | NUTF2 | physical | 7744965 | |
RAN_HUMAN | RAN | physical | 10228171 | |
RAN_HUMAN | RAN | physical | 22939629 | |
NTF2_HUMAN | NUTF2 | physical | 25416956 | |
NUP62_HUMAN | NUP62 | physical | 25416956 | |
NUP62_HUMAN | NUP62 | physical | 16730000 | |
AP2A1_HUMAN | AP2A1 | physical | 26344197 | |
AP2A2_HUMAN | AP2A2 | physical | 26344197 | |
NNRE_HUMAN | APOA1BP | physical | 26344197 | |
CGL_HUMAN | CTH | physical | 26344197 | |
GPX4_HUMAN | GPX4 | physical | 26344197 | |
HINT1_HUMAN | HINT1 | physical | 26344197 | |
PCP_HUMAN | PRCP | physical | 26344197 | |
RAB7A_HUMAN | RAB7A | physical | 26344197 | |
RHOA_HUMAN | RHOA | physical | 26344197 | |
TNG2_HUMAN | TANGO2 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-4, AND MASS SPECTROMETRY. |