UniProt ID | NNRE_HUMAN | |
---|---|---|
UniProt AC | Q8NCW5 | |
Protein Name | NAD(P)H-hydrate epimerase {ECO:0000255|HAMAP-Rule:MF_03159} | |
Gene Name | NAXE {ECO:0000312|HGNC:HGNC:18453} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 288 | |
Subcellular Localization | Mitochondrion . Secreted . In sperm, secretion gradually increases during capacitation. | |
Protein Description | Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX.. | |
Protein Sequence | MSRLRALLGLGLLVAGSRVPRIKSQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Phosphorylation | SRVPRIKSQTIACRS CCCCCCCCCEEEECC | 30.13 | - | |
29 (in isoform 2) | Ubiquitination | - | 2.92 | 21890473 | |
34 | O-linked_Glycosylation | IACRSGPTWWGPQRL EEECCCCCCCCCCCC | 37.06 | 55834729 | |
49 | Phosphorylation | NSGGRWDSEVMASTV CCCCCCCHHHHHHHH | 25.73 | 26356563 | |
54 | Phosphorylation | WDSEVMASTVVKYLS CCHHHHHHHHHHHCC | 12.02 | 26356563 | |
55 | Phosphorylation | DSEVMASTVVKYLSQ CHHHHHHHHHHHCCH | 21.56 | 26356563 | |
132 | Ubiquitination | LVCARHLKLFGYEPT EEECHHHHHCCCCCE | 35.33 | 32015554 | |
132 (in isoform 1) | Ubiquitination | - | 35.33 | 21890473 | |
132 | Acetylation | LVCARHLKLFGYEPT EEECHHHHHCCCCCE | 35.33 | 25953088 | |
136 | Phosphorylation | RHLKLFGYEPTIYYP HHHHHCCCCCEEECC | 16.05 | 24719451 | |
139 | Phosphorylation | KLFGYEPTIYYPKRP HHCCCCCEEECCCCC | 15.07 | 28152594 | |
141 | Phosphorylation | FGYEPTIYYPKRPNK CCCCCEEECCCCCCC | 19.05 | 28152594 | |
142 | Phosphorylation | GYEPTIYYPKRPNKP CCCCEEECCCCCCCC | 9.83 | 28152594 | |
144 | Acetylation | EPTIYYPKRPNKPLF CCEEECCCCCCCCCH | 65.45 | 7625399 | |
144 | Succinylation | EPTIYYPKRPNKPLF CCEEECCCCCCCCCH | 65.45 | - | |
144 | Succinylation | EPTIYYPKRPNKPLF CCEEECCCCCCCCCH | 65.45 | - | |
148 | Acetylation | YYPKRPNKPLFTALV ECCCCCCCCCHHHHH | 45.86 | 25953088 | |
148 | Malonylation | YYPKRPNKPLFTALV ECCCCCCCCCHHHHH | 45.86 | 26320211 | |
191 | Phosphorylation | VDAIFGFSFKGDVRE HHHHHCCCCCCCCCC | 26.82 | 24719451 | |
240 | Phosphorylation | IQPDLLISLTAPKKS CCCCEEEEEECCCCC | 21.45 | - | |
245 | Ubiquitination | LISLTAPKKSATQFT EEEEECCCCCCCCCC | 57.82 | 29967540 | |
245 | 2-Hydroxyisobutyrylation | LISLTAPKKSATQFT EEEEECCCCCCCCCC | 57.82 | - | |
246 | Ubiquitination | ISLTAPKKSATQFTG EEEECCCCCCCCCCC | 44.24 | 27667366 | |
247 | Phosphorylation | SLTAPKKSATQFTGR EEECCCCCCCCCCCC | 42.55 | 26437602 | |
249 | Phosphorylation | TAPKKSATQFTGRYH ECCCCCCCCCCCCEE | 31.16 | 26437602 | |
252 | Phosphorylation | KKSATQFTGRYHYLG CCCCCCCCCCEEEEC | 15.78 | - | |
255 | Phosphorylation | ATQFTGRYHYLGGRF CCCCCCCEEEECCEE | 9.00 | 24927040 | |
257 | Phosphorylation | QFTGRYHYLGGRFVP CCCCCEEEECCEECC | 9.71 | 28152594 | |
261 | Methylation | RYHYLGGRFVPPALE CEEEECCEECCHHHH | 27.82 | - | |
269 | 2-Hydroxyisobutyrylation | FVPPALEKKYQLNLP ECCHHHHHHCCCCCC | 58.60 | - | |
269 | Succinylation | FVPPALEKKYQLNLP ECCHHHHHHCCCCCC | 58.60 | 23954790 | |
269 | Ubiquitination | FVPPALEKKYQLNLP ECCHHHHHHCCCCCC | 58.60 | 32015554 | |
270 | Ubiquitination | VPPALEKKYQLNLPP CCHHHHHHCCCCCCC | 28.93 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NNRE_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NNRE_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NNRE_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
APOA1_HUMAN | APOA1 | physical | 11991719 | |
ARMT1_HUMAN | C6orf211 | physical | 26344197 | |
DPYD_HUMAN | DPYD | physical | 26344197 | |
ES8L2_HUMAN | EPS8L2 | physical | 26344197 | |
FADD_HUMAN | FADD | physical | 26344197 | |
MEMO1_HUMAN | MEMO1 | physical | 26344197 | |
UB2G1_HUMAN | UBE2G1 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...