| UniProt ID | FKB1B_HUMAN | |
|---|---|---|
| UniProt AC | P68106 | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP1B | |
| Gene Name | FKBP1B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 108 | |
| Subcellular Localization | Cytoplasm. Sarcoplasmic reticulum. | |
| Protein Description | Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.. | |
| Protein Sequence | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 22 | Phosphorylation | TFPKKGQTCVVHYTG CCCCCCCEEEEEEEE | 18.88 | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKB1B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKB1B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKB1B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RYR2_HUMAN | RYR2 | physical | 12446682 | |
| K1H1_HUMAN | KRT31 | physical | 25416956 | |
| REL_HUMAN | REL | physical | 25416956 | |
| ATL4_HUMAN | ADAMTSL4 | physical | 25416956 | |
| GMCL1_HUMAN | GMCL1 | physical | 25416956 | |
| K1C40_HUMAN | KRT40 | physical | 25416956 | |
| TRI69_HUMAN | TRIM69 | physical | 25416956 | |
| DDAH2_HUMAN | DDAH2 | physical | 26344197 | |
| HCD2_HUMAN | HSD17B10 | physical | 26344197 | |
| ITPA_HUMAN | ITPA | physical | 26344197 | |
| RYR3_HUMAN | RYR3 | physical | 11598113 | |
| RYR2_HUMAN | RYR2 | physical | 21262961 | |
| FKB1B_HUMAN | FKBP1B | physical | 23747301 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
