UniProt ID | ARF4_HUMAN | |
---|---|---|
UniProt AC | P18085 | |
Protein Name | ADP-ribosylation factor 4 | |
Gene Name | ARF4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 180 | |
Subcellular Localization |
Golgi apparatus. Membrane Lipid-anchor . |
|
Protein Description | GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.. | |
Protein Sequence | MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGLTISSLF ------CCCCHHHHH | 31.37 | 25255805 | |
4 | Phosphorylation | ----MGLTISSLFSR ----CCCCHHHHHHH | 17.06 | 24043423 | |
6 | Phosphorylation | --MGLTISSLFSRLF --CCCCHHHHHHHHH | 18.76 | 24043423 | |
7 | Phosphorylation | -MGLTISSLFSRLFG -CCCCHHHHHHHHHC | 29.59 | 24043423 | |
10 | Phosphorylation | LTISSLFSRLFGKKQ CCHHHHHHHHHCCCC | 33.11 | 24043423 | |
15 | Ubiquitination | LFSRLFGKKQMRILM HHHHHHCCCCEEEEE | 32.28 | 21906983 | |
16 | Ubiquitination | FSRLFGKKQMRILMV HHHHHCCCCEEEEEE | 50.10 | 21890473 | |
22 | Sulfoxidation | KKQMRILMVGLDAAG CCCEEEEEEEECCCC | 1.77 | 21406390 | |
35 | Phosphorylation | AGKTTILYKLKLGEI CCCEEEEEEEECCCE | 15.49 | - | |
36 | Acetylation | GKTTILYKLKLGEIV CCEEEEEEEECCCEE | 35.38 | 26051181 | |
36 | Ubiquitination | GKTTILYKLKLGEIV CCEEEEEEEECCCEE | 35.38 | 21963094 | |
38 | Ubiquitination | TTILYKLKLGEIVTT EEEEEEEECCCEEEE | 50.74 | 21906983 | |
45 | O-linked_Glycosylation | KLGEIVTTIPTIGFN ECCCEEEECCCCCCC | 17.67 | OGP | |
48 | O-linked_Glycosylation | EIVTTIPTIGFNVET CEEEECCCCCCCCEE | 29.86 | OGP | |
58 | Phosphorylation | FNVETVEYKNICFTV CCCEEEEEEEEEEEE | 12.66 | - | |
81 | Phosphorylation | IRPLWKHYFQNTQGL CHHHHHHHHCCCCEE | 11.79 | 28152594 | |
85 | Phosphorylation | WKHYFQNTQGLIFVV HHHHHCCCCEEEEEE | 17.15 | 28152594 | |
109 | Ubiquitination | EVADELQKMLLVDEL HHHHHHHHHHHHHHH | 44.11 | 21906983 | |
127 | Ubiquitination | VLLLFANKQDLPNAM HHHHHCCCCCCCCHH | 41.58 | 21906983 | |
134 | Sulfoxidation | KQDLPNAMAISEMTD CCCCCCHHHHHHHCH | 4.29 | 30846556 | |
137 | Phosphorylation | LPNAMAISEMTDKLG CCCHHHHHHHCHHHC | 16.27 | 27251275 | |
139 | Sulfoxidation | NAMAISEMTDKLGLQ CHHHHHHHCHHHCHH | 4.72 | 30846556 | |
142 | Ubiquitination | AISEMTDKLGLQSLR HHHHHCHHHCHHHHH | 34.98 | 22817900 | |
147 | Phosphorylation | TDKLGLQSLRNRTWY CHHHCHHHHHCCEEE | 34.05 | 19664994 | |
152 | Phosphorylation | LQSLRNRTWYVQATC HHHHHCCEEEEEEEE | 25.38 | - | |
167 | Phosphorylation | ATQGTGLYEGLDWLS ECCCCCHHHHHHHHH | 14.86 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ZN363_HUMAN | RCHY1 | physical | 21988832 | |
SDCB2_HUMAN | SDCBP2 | physical | 25416956 | |
ACADM_HUMAN | ACADM | physical | 26344197 | |
FUBP1_HUMAN | FUBP1 | physical | 26344197 | |
FUBP3_HUMAN | FUBP3 | physical | 26344197 | |
RACK1_HUMAN | GNB2L1 | physical | 26344197 | |
IDHC_HUMAN | IDH1 | physical | 26344197 | |
LEG1_HUMAN | LGALS1 | physical | 26344197 | |
PCBP2_HUMAN | PCBP2 | physical | 26344197 | |
SERC_HUMAN | PSAT1 | physical | 26344197 | |
UBE2N_HUMAN | UBE2N | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-36, AND MASS SPECTROMETRY. |