ELOC_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ELOC_RAT
• UniProt AC: P83941
• Protein Name: Elongin-C
• Gene Name: Eloc
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 112
• Subcellular Localization: Nucleus .
• Protein Description: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (By similarity). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).; The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes..
• Protein Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	S-nitrosocysteine	EEKTYGGCEGPDAMY CCCCCCCCCCCCEEE	4.79	-
11	S-nitrosylation	EEKTYGGCEGPDAMY CCCCCCCCCCCCEEE	4.79	21278135
39	Phosphorylation	KREHALTSGTIKAML ECCEEECCCCHHHHH	34.49	23984901
41	Phosphorylation	EHALTSGTIKAMLSG CEEECCCCHHHHHCC	21.04	23984901
74	S-nitrosocysteine	SHVLSKVCMYFTYKV HHHHHHHHHHEEEEE	1.79	-
74	S-nitrosylation	SHVLSKVCMYFTYKV HHHHHHHHHHEEEEE	1.79	21278135

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ELOC_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ELOC_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ELOC_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of ELOC_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.