| UniProt ID | UBE2S_HUMAN | |
|---|---|---|
| UniProt AC | Q16763 | |
| Protein Name | Ubiquitin-conjugating enzyme E2 S | |
| Gene Name | UBE2S | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 222 | |
| Subcellular Localization | ||
| Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. [PubMed: 22496338 Catalyzes 'Lys-11'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by specifically elongating 'Lys-11'-linked polyubiquitin chains initiated by the E2 enzyme UBE2C/UBCH10 on APC/C substrates, enhancing the degradation of APC/C substrates by the proteasome and promoting mitotic exit] | |
| Protein Sequence | MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MNSNVENL -------CCCCHHHC | 12.84 | 19413330 | |
| 18 | Ubiquitination | HIIRLVYKEVTTLTA HHHHHHEEEEEECCC | 37.92 | 21963094 | |
| 32 | Ubiquitination | ADPPDGIKVFPNEED CCCCCCEEECCCHHH | 43.27 | 33845483 | |
| 63 | Acetylation | AGGLFRMKLLLGKDF CCCEEHEEHHHCCCC | 31.55 | 25953088 | |
| 63 | Ubiquitination | AGGLFRMKLLLGKDF CCCEEHEEHHHCCCC | 31.55 | 23000965 | |
| 68 | Acetylation | RMKLLLGKDFPASPP HEEHHHCCCCCCCCC | 57.05 | 90475 | |
| 68 | 2-Hydroxyisobutyrylation | RMKLLLGKDFPASPP HEEHHHCCCCCCCCC | 57.05 | - | |
| 68 | Ubiquitination | RMKLLLGKDFPASPP HEEHHHCCCCCCCCC | 57.05 | 23000965 | |
| 73 | Phosphorylation | LGKDFPASPPKGYFL HCCCCCCCCCCCEEE | 41.81 | 30266825 | |
| 76 | Ubiquitination | DFPASPPKGYFLTKI CCCCCCCCCEEEEEE | 70.40 | 27667366 | |
| 78 | Phosphorylation | PASPPKGYFLTKIFH CCCCCCCEEEEEECC | 11.09 | 26074081 | |
| 81 | Phosphorylation | PPKGYFLTKIFHPNV CCCCEEEEEECCCCC | 16.52 | - | |
| 82 | Ubiquitination | PKGYFLTKIFHPNVG CCCEEEEEECCCCCC | 45.59 | 21963094 | |
| 82 | Acetylation | PKGYFLTKIFHPNVG CCCEEEEEECCCCCC | 45.59 | 26051181 | |
| 100 | Ubiquitination | EICVNVLKRDWTAEL EEEEEECCCCCHHHH | 43.99 | 23000965 | |
| 100 | Acetylation | EICVNVLKRDWTAEL EEEEEECCCCCHHHH | 43.99 | 25953088 | |
| 117 | Ubiquitination | RHVLLTIKCLLIHPN HHHHHEEEEEECCCC | 17.37 | 21906983 | |
| 152 | Phosphorylation | AARARLLTEIHGGAG HHHHHHHHHHHCCCC | 37.17 | - | |
| 162 | Phosphorylation | HGGAGGPSGRAEAGR HCCCCCCCHHHHHHH | 44.16 | 28555341 | |
| 173 | Phosphorylation | EAGRALASGTEASST HHHHHHHCCCCCCCC | 47.28 | 26074081 | |
| 175 | Phosphorylation | GRALASGTEASSTDP HHHHHCCCCCCCCCC | 26.36 | 18669648 | |
| 178 | Phosphorylation | LASGTEASSTDPGAP HHCCCCCCCCCCCCC | 27.78 | 28555341 | |
| 179 | Phosphorylation | ASGTEASSTDPGAPG HCCCCCCCCCCCCCC | 43.83 | 28985074 | |
| 180 | Phosphorylation | SGTEASSTDPGAPGG CCCCCCCCCCCCCCC | 43.66 | 21712546 | |
| 195 | Sulfoxidation | PGGAEGPMAKKHAGE CCCCCCCHHHHCCCH | 14.53 | 21406390 | |
| 197 | Acetylation | GAEGPMAKKHAGERD CCCCCHHHHCCCHHH | 38.55 | 25953088 | |
| 197 | Ubiquitination | GAEGPMAKKHAGERD CCCCCHHHHCCCHHH | 38.55 | 21963094 | |
| 198 | Ubiquitination | AEGPMAKKHAGERDK CCCCHHHHCCCHHHH | 29.20 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 152 | T | Phosphorylation | Kinase | AKT1 | P31749 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBE2S_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBE2S_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. | |