DPM3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DPM3_HUMAN
• UniProt AC: Q9P2X0
• Protein Name: Dolichol-phosphate mannosyltransferase subunit 3
• Gene Name: DPM3
• Organism: Homo sapiens (Human).
• Sequence Length: 92
• Subcellular Localization: Endoplasmic reticulum membrane; Multi-pass membrane protein.
• Protein Description: Stabilizer subunit of the dolichol-phosphate mannose (DPM) synthase complex; tethers catalytic subunit DPM1 to the ER..
• Protein Sequence: MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGLRF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
63	O-linked_Glycosylation	TVGYRVATFHDCEDA CCCEEEEECCCHHHH	20.74	310709277
63	Phosphorylation	TVGYRVATFHDCEDA CCCEEEEECCCHHHH	20.74	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DPM3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DPM3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DPM3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DPM1_HUMAN	DPM1	physical	16280320

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.