dbPTM

COXM2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COXM2_HUMAN
UniProt AC	Q9NRP2
Protein Name	COX assembly mitochondrial protein 2 homolog
Gene Name	CMC2
Organism	Homo sapiens (Human).
Sequence Length	79
Subcellular Localization	Mitochondrion .
Protein Description	May be involved in cytochrome c oxidase biogenesis..
Protein Sequence	MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESEK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Phosphorylation	NILKFFGYCNDVDRE CHHHHHHCHHHHHHH	5.28	25884760
52	Phosphorylation	RKCLKNEYVENRTKS HHHHHHHHHHHHHHH	23.58	-
57	Phosphorylation	NEYVENRTKSREHGI HHHHHHHHHHHHHCH	44.98	26434776
59	Phosphorylation	YVENRTKSREHGIAM HHHHHHHHHHHCHHH	42.14	26434776
69	Ubiquitination	HGIAMRKKLFNPPEE HCHHHHHHHCCCCHH	48.20	29967540
77	Phosphorylation	LFNPPEESEK----- HCCCCHHHCC-----	49.36	29396449
79	Ubiquitination	NPPEESEK------- CCCHHHCC-------	74.95	24816145
162	Ubiquitination	------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------		24816145
205	Ubiquitination	------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------		24816145

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COXM2_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COXM2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COXM2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of COXM2_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COXM2_HUMAN

Related Literatures of Post-Translational Modification