UniProt ID | COXM2_HUMAN | |
---|---|---|
UniProt AC | Q9NRP2 | |
Protein Name | COX assembly mitochondrial protein 2 homolog | |
Gene Name | CMC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 79 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | May be involved in cytochrome c oxidase biogenesis.. | |
Protein Sequence | MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESEK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Phosphorylation | NILKFFGYCNDVDRE CHHHHHHCHHHHHHH | 5.28 | 25884760 | |
52 | Phosphorylation | RKCLKNEYVENRTKS HHHHHHHHHHHHHHH | 23.58 | - | |
57 | Phosphorylation | NEYVENRTKSREHGI HHHHHHHHHHHHHCH | 44.98 | 26434776 | |
59 | Phosphorylation | YVENRTKSREHGIAM HHHHHHHHHHHCHHH | 42.14 | 26434776 | |
69 | Ubiquitination | HGIAMRKKLFNPPEE HCHHHHHHHCCCCHH | 48.20 | 29967540 | |
77 | Phosphorylation | LFNPPEESEK----- HCCCCHHHCC----- | 49.36 | 29396449 | |
79 | Ubiquitination | NPPEESEK------- CCCHHHCC------- | 74.95 | 24816145 | |
162 | Ubiquitination | ------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------ | 24816145 | ||
205 | Ubiquitination | ------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------- | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COXM2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COXM2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COXM2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of COXM2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...