UniProt ID | CRTAP_HUMAN | |
---|---|---|
UniProt AC | O75718 | |
Protein Name | Cartilage-associated protein | |
Gene Name | CRTAP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 401 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
Protein Description | Necessary for efficient 3-hydroxylation of fibrillar collagen prolyl residues.. | |
Protein Sequence | MEPGRRGAAALLALLCVACALRAGRAQYERYSFRSFPRDELMPLESAYRHALDKYSGEHWAESVGYLEISLRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYESLFIRAVRAYNGENWRTSITDMELALPDFFKAFYECLAACEGSREIKDFKDFYLSIADHYVEVLECKIQCEENLTPVIGGYPVEKFVATMYHYLQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Phosphorylation | RAQYERYSFRSFPRD HHHHHHCCCCCCCHH | 22.02 | 29496963 | |
42 | Sulfoxidation | SFPRDELMPLESAYR CCCHHHHCCHHHHHH | 3.15 | 30846556 | |
55 | Phosphorylation | YRHALDKYSGEHWAE HHHHHHHCCCCHHHH | 22.90 | 23663014 | |
56 | Phosphorylation | RHALDKYSGEHWAES HHHHHHCCCCHHHHH | 43.37 | 23663014 | |
63 | Phosphorylation | SGEHWAESVGYLEIS CCCHHHHHHCHHHHH | 17.07 | 23663014 | |
66 | Phosphorylation | HWAESVGYLEISLRL HHHHHHCHHHHHHHH | 10.06 | 23663014 | |
87 | N-linked_Glycosylation | SEAFCHRNCSAAPQP CHHHHCCCCCCCCCC | 10.63 | UniProtKB CARBOHYD | |
89 | O-linked_Glycosylation | AFCHRNCSAAPQPEP HHHCCCCCCCCCCCC | 30.89 | 30059200 | |
123 | Ubiquitination | AHCLKRCKQGLPAFR HHHHHHHHCCCHHHH | 51.97 | 29967540 | |
149 | Ubiquitination | FQRREPYKFLQFAYF HHHCCCHHHHHHHHH | 50.76 | 21963094 | |
157 | Ubiquitination | FLQFAYFKANNLPKA HHHHHHHHHCCHHHH | 37.21 | 21906983 | |
163 | Ubiquitination | FKANNLPKAIAAAHT HHHCCHHHHHHHHHH | 56.44 | 21963094 | |
174 | Ubiquitination | AAHTFLLKHPDDEMM HHHHHHHHCCCHHHH | 56.06 | 21963094 | |
182 | 2-Hydroxyisobutyrylation | HPDDEMMKRNMAYYK CCCHHHHHHHHHHHH | 39.03 | - | |
182 | Ubiquitination | HPDDEMMKRNMAYYK CCCHHHHHHHHHHHH | 39.03 | 21906983 | |
189 | Ubiquitination | KRNMAYYKSLPGAED HHHHHHHHCCCCHHH | 32.61 | 21906983 | |
190 | Phosphorylation | RNMAYYKSLPGAEDY HHHHHHHCCCCHHHH | 24.55 | 22985185 | |
197 | Phosphorylation | SLPGAEDYIKDLETK CCCCHHHHHHHHCCC | 11.02 | 24719451 | |
199 | Ubiquitination | PGAEDYIKDLETKSY CCHHHHHHHHCCCCH | 50.46 | 21963094 | |
204 | Ubiquitination | YIKDLETKSYESLFI HHHHHCCCCHHHHHH | 41.48 | 21906983 | |
241 | Phosphorylation | PDFFKAFYECLAACE HHHHHHHHHHHHHCC | 15.59 | 28152594 | |
307 | Ubiquitination | YLQFAYYKLNDLKNA HHHHHHHHHHCHHCH | 28.30 | 22817900 | |
312 | Ubiquitination | YYKLNDLKNAAPCAV HHHHHCHHCHHHCHH | 47.61 | 21963094 | |
329 | Ubiquitination | LLFDQNDKVMQQNLV HEEECCCHHHHHHEE | 47.35 | 21963094 | |
363 | N-linked_Glycosylation | PEAVQFFNVTTLQKE HHHHHEEECHHHHHH | 31.36 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRTAP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRTAP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRTAP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ARMC9_HUMAN | ARMC9 | physical | 22863883 | |
GPN1_HUMAN | GPN1 | physical | 22863883 | |
SH3G1_HUMAN | SH3GL1 | physical | 22863883 | |
SHLB2_HUMAN | SH3GLB2 | physical | 22863883 | |
SURF2_HUMAN | SURF2 | physical | 22863883 | |
TM1L1_HUMAN | TOM1L1 | physical | 22863883 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
610682 | Osteogenesis imperfecta 7 (OI7) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...