ELOB_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ELOB_RAT
• UniProt AC: P62870
• Protein Name: Elongin-B
• Gene Name: Elob
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 118
• Subcellular Localization: Nucleus .
• Protein Description: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (By similarity). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).; The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes..
• Protein Sequence: MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDVFLMIR -------CCEEEEEE	10.01	-
46	Acetylation	PEEQRLYKDDQLLDD HHHHHCCCCCCCCCC	60.46	72534129
46	Succinylation	PEEQRLYKDDQLLDD HHHHHCCCCCCCCCC	60.46	26843850
84	Phosphorylation	LAFRADDTFEALRIE EEEECCCCCHHEEEC	24.75	28432305
94	Phosphorylation	ALRIEPFSSPPELPD HEEECCCCCCCCCCC	53.29	22673903
95	Phosphorylation	LRIEPFSSPPELPDV EEECCCCCCCCCCCC	44.87	22673903
108	Phosphorylation	DVMKPQDSGGSANEQ CCCCCCCCCCCCHHH	39.54	27097102
111	Phosphorylation	KPQDSGGSANEQAVQ CCCCCCCCCHHHHCC	31.29	27097102

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ELOB_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ELOB_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ELOB_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELOC_RAT	Tceb1	physical	11384984
ELOC_RAT	Tceb1	physical	10224134

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.