UniProt ID | CK5P3_HUMAN | |
---|---|---|
UniProt AC | Q96JB5 | |
Protein Name | CDK5 regulatory subunit-associated protein 3 {ECO:0000312} | |
Gene Name | CDK5RAP3 {ECO:0000312|HGNC:HGNC:18673} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 506 | |
Subcellular Localization | Nucleus . Cytoplasm . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Colocalizes and associates with microtubules. | |
Protein Description | Probable tumor suppressor initially identified as a CDK5R1 interactor controlling cell proliferation. [PubMed: 12054757] | |
Protein Sequence | MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Ubiquitination | DRRHCSLKWQSLVLT HCCCCCCCHHHHHHH | 27.22 | - | |
48 | Ubiquitination | INAAIQDMPESEEIA HHHHHHCCCCHHHHH | 1.96 | 29967540 | |
73 | Ubiquitination | FHCLRILDLLKGTEA HHHHHHHHHHCCCCC | 47.81 | 23000965 | |
76 | Ubiquitination | LRILDLLKGTEASTK HHHHHHHCCCCCCCC | 71.70 | 33845483 | |
78 | Phosphorylation | ILDLLKGTEASTKNI HHHHHCCCCCCCCCC | 27.13 | 30576142 | |
79 | Neddylation | LDLLKGTEASTKNIF HHHHCCCCCCCCCCC | 49.65 | 32015554 | |
79 | Ubiquitination | LDLLKGTEASTKNIF HHHHCCCCCCCCCCC | 49.65 | 23000965 | |
79 (in isoform 2) | Ubiquitination | - | 49.65 | 21890473 | |
81 | Phosphorylation | LLKGTEASTKNIFGR HHCCCCCCCCCCCCC | 33.41 | 24719451 | |
82 | Phosphorylation | LKGTEASTKNIFGRY HCCCCCCCCCCCCCC | 34.85 | 24719451 | |
83 | Ubiquitination | KGTEASTKNIFGRYS CCCCCCCCCCCCCCC | 45.62 | 27667366 | |
101 | Ubiquitination | MKDWQEIIALYEKDN CCCHHHHHHHHHCCC | 1.81 | 33845483 | |
104 | Phosphorylation | WQEIIALYEKDNTYL HHHHHHHHHCCCEEE | 16.35 | - | |
108 | Ubiquitination | IALYEKDNTYLVELS HHHHHCCCEEEEEHH | 41.51 | - | |
108 | Ubiquitination | IALYEKDNTYLVELS HHHHHCCCEEEEEHH | 41.51 | 33845483 | |
109 | Phosphorylation | ALYEKDNTYLVELSS HHHHCCCEEEEEHHH | 28.50 | 20068231 | |
110 | Phosphorylation | LYEKDNTYLVELSSL HHHCCCEEEEEHHHH | 18.27 | 20068231 | |
115 | Phosphorylation | NTYLVELSSLLVRNV CEEEEEHHHHHHHHC | 12.87 | 20068231 | |
116 | Phosphorylation | TYLVELSSLLVRNVN EEEEEHHHHHHHHCC | 38.04 | 20068231 | |
124 | Phosphorylation | LLVRNVNYEIPSLKK HHHHHCCCCCCCHHH | 15.79 | 28152594 | |
128 | Phosphorylation | NVNYEIPSLKKQIAK HCCCCCCCHHHHHHH | 59.49 | 24719451 | |
130 | 2-Hydroxyisobutyrylation | NYEIPSLKKQIAKCQ CCCCCCHHHHHHHHH | 47.14 | - | |
135 | Ubiquitination | SLKKQIAKCQQLQQE CHHHHHHHHHHHHHH | 33.92 | 29967540 | |
143 | Phosphorylation | CQQLQQEYSRKEEEC HHHHHHHHHHCHHHH | 14.94 | 20860994 | |
144 | Phosphorylation | QQLQQEYSRKEEECQ HHHHHHHHHCHHHHH | 35.80 | 20860994 | |
146 | Acetylation | LQQEYSRKEEECQAG HHHHHHHCHHHHHHH | 64.63 | 26051181 | |
146 | Ubiquitination | LQQEYSRKEEECQAG HHHHHHHCHHHHHHH | 64.63 | - | |
156 | Ubiquitination | ECQAGAAEMREQFYH HHHHHHHHHHHHHHH | 37.93 | - | |
160 | Ubiquitination | GAAEMREQFYHSCKQ HHHHHHHHHHHHHHH | 33.56 | - | |
160 | Ubiquitination | GAAEMREQFYHSCKQ HHHHHHHHHHHHHHH | 33.56 | 29967540 | |
162 | Phosphorylation | AEMREQFYHSCKQYG HHHHHHHHHHHHHHC | 7.78 | 28152594 | |
164 | Phosphorylation | MREQFYHSCKQYGIT HHHHHHHHHHHHCCC | 16.19 | 28152594 | |
166 | Acetylation | EQFYHSCKQYGITGE HHHHHHHHHHCCCCC | 49.96 | 26051181 | |
166 | Malonylation | EQFYHSCKQYGITGE HHHHHHHHHHCCCCC | 49.96 | 32601280 | |
166 | Neddylation | EQFYHSCKQYGITGE HHHHHHHHHHCCCCC | 49.96 | 32015554 | |
166 | Ubiquitination | EQFYHSCKQYGITGE HHHHHHHHHHCCCCC | 49.96 | 23000965 | |
170 | Ubiquitination | HSCKQYGITGENVRG HHHHHHCCCCCCHHH | 3.68 | 33845483 | |
170 (in isoform 3) | Ubiquitination | - | 3.68 | 21906983 | |
171 | Ubiquitination | SCKQYGITGENVRGE HHHHHCCCCCCHHHH | 33.80 | - | |
172 | Ubiquitination | CKQYGITGENVRGEL HHHHCCCCCCHHHHH | 23.66 | 23503661 | |
191 | Ubiquitination | KDLPSQLAEIGAAAQ HCHHHHHHHHHHHHH | 9.95 | 21890473 | |
191 | Ubiquitination | KDLPSQLAEIGAAAQ HCHHHHHHHHHHHHH | 9.95 | - | |
191 | Neddylation | KDLPSQLAEIGAAAQ HCHHHHHHHHHHHHH | 9.95 | 32015554 | |
191 | Ubiquitination | KDLPSQLAEIGAAAQ HCHHHHHHHHHHHHH | 9.95 | 23000965 | |
191 (in isoform 1) | Ubiquitination | - | 9.95 | 21890473 | |
217 | Ubiquitination | ASVGFVCESPTEQVL CCCCEEECCCHHHHH | 55.22 | 33845483 | |
225 | Ubiquitination | SPTEQVLPMLRFVQK CCHHHHHHHHHHHHH | 22.39 | 29967540 | |
226 | Ubiquitination | PTEQVLPMLRFVQKR CHHHHHHHHHHHHHH | 3.52 | 23503661 | |
232 | Ubiquitination | PMLRFVQKRGNSTVY HHHHHHHHHCCCCEE | 57.90 | 23503661 | |
233 | Methylation | MLRFVQKRGNSTVYE HHHHHHHHCCCCEEE | 32.22 | - | |
239 | Phosphorylation | KRGNSTVYEWRTGTE HHCCCCEEEECCCCC | 15.17 | - | |
243 | Phosphorylation | STVYEWRTGTEPSVV CCEEEECCCCCCCCC | 49.91 | 20068231 | |
245 | Phosphorylation | VYEWRTGTEPSVVER EEEECCCCCCCCCCC | 44.07 | 20068231 | |
246 | Ubiquitination | YEWRTGTEPSVVERP EEECCCCCCCCCCCC | 36.60 | 29967540 | |
248 | Phosphorylation | WRTGTEPSVVERPHL ECCCCCCCCCCCCCH | 32.34 | 20068231 | |
253 | Ubiquitination | EPSVVERPHLEELPE CCCCCCCCCHHHCCH | 23.94 | 33845483 | |
253 (in isoform 3) | Ubiquitination | - | 23.94 | 21906983 | |
259 | Ubiquitination | RPHLEELPEQVAEDA CCCHHHCCHHHHHHC | 33.00 | 29967540 | |
267 | Ubiquitination | EQVAEDAIDWGDFGV HHHHHHCCCCCCCCE | 7.66 | 32015554 | |
302 | Ubiquitination | GIFPESDSKDPGGDG CCCCCCCCCCCCCCC | 48.51 | 23503661 | |
304 | Ubiquitination | FPESDSKDPGGDGID CCCCCCCCCCCCCCC | 51.53 | 23503661 | |
308 | Ubiquitination | DSKDPGGDGIDWGDD CCCCCCCCCCCCCHH | 57.71 | 33845483 | |
308 (in isoform 2) | Ubiquitination | - | 57.71 | 21890473 | |
310 | Ubiquitination | KDPGGDGIDWGDDAV CCCCCCCCCCCHHHE | 4.85 | 23503661 | |
342 | Phosphorylation | ARGPDALTLLEYTET HCCCCHHHHHHCHHH | 30.90 | 24043423 | |
346 | Phosphorylation | DALTLLEYTETRNQF CHHHHHHCHHHHHHH | 15.17 | 24043423 | |
347 | Phosphorylation | ALTLLEYTETRNQFL HHHHHHCHHHHHHHH | 22.85 | 24043423 | |
349 | Phosphorylation | TLLEYTETRNQFLDE HHHHCHHHHHHHHHH | 27.41 | 24043423 | |
355 | Ubiquitination | ETRNQFLDELMELEI HHHHHHHHHHHHHHH | 48.55 | 33845483 | |
358 | Ubiquitination | NQFLDELMELEIFLA HHHHHHHHHHHHHHH | 5.34 | 23503661 | |
363 | Ubiquitination | ELMELEIFLAQRAVE HHHHHHHHHHHHHHH | 3.18 | 29967540 | |
364 | Ubiquitination | LMELEIFLAQRAVEL HHHHHHHHHHHHHHH | 4.95 | 23503661 | |
370 | Ubiquitination | FLAQRAVELSEEADV HHHHHHHHHHHHCCE | 45.66 | 23503661 | |
370 (in isoform 2) | Ubiquitination | - | 45.66 | - | |
372 | Phosphorylation | AQRAVELSEEADVLS HHHHHHHHHHCCEEE | 21.64 | - | |
384 | Ubiquitination | VLSVSQFQLAPAILQ EEEHHHHHHHHHHHC | 29.13 | 29967540 | |
391 | Ubiquitination | QLAPAILQGQTKEKM HHHHHHHCCCCHHHH | 35.52 | 33845483 | |
391 (in isoform 2) | Ubiquitination | - | 35.52 | 21890473 | |
394 | Phosphorylation | PAILQGQTKEKMVTM HHHHCCCCHHHHHHH | 48.25 | - | |
395 | Ubiquitination | AILQGQTKEKMVTMV HHHCCCCHHHHHHHH | 47.66 | 21906983 | |
397 | Ubiquitination | LQGQTKEKMVTMVSV HCCCCHHHHHHHHHH | 39.98 | 23503661 | |
400 | Phosphorylation | QTKEKMVTMVSVLED CCHHHHHHHHHHHHH | 14.35 | 22210691 | |
403 | Phosphorylation | EKMVTMVSVLEDLIG HHHHHHHHHHHHHHH | 15.34 | 30631047 | |
405 | Ubiquitination | MVTMVSVLEDLIGKL HHHHHHHHHHHHHHH | 3.10 | 32015554 | |
420 | Ubiquitination | TSLQLQHLFMILASP HHHHHHHHHHHHHCH | 1.69 | - | |
420 | Ubiquitination | TSLQLQHLFMILASP HHHHHHHHHHHHHCH | 1.69 | 33845483 | |
420 (in isoform 1) | Ubiquitination | - | 1.69 | 21890473 | |
422 | Ubiquitination | LQLQHLFMILASPRY HHHHHHHHHHHCHHH | 2.86 | 23503661 | |
440 | Ubiquitination | VTEFLQQKLKQSQLL HHHHHHHHHHHHHHH | 44.70 | - | |
442 | Ubiquitination | EFLQQKLKQSQLLAL HHHHHHHHHHHHHHH | 55.74 | 33845483 | |
450 | Sumoylation | QSQLLALKKELMVQK HHHHHHHHHHHHHHH | 38.30 | - | |
450 | Sumoylation | QSQLLALKKELMVQK HHHHHHHHHHHHHHH | 38.30 | 25772364 | |
450 | Ubiquitination | QSQLLALKKELMVQK HHHHHHHHHHHHHHH | 38.30 | 29967540 | |
451 | Ubiquitination | SQLLALKKELMVQKQ HHHHHHHHHHHHHHH | 57.86 | 23503661 | |
457 | Ubiquitination | KKELMVQKQQEALEE HHHHHHHHHHHHHHH | 42.40 | 23503661 | |
465 | Ubiquitination | QQEALEEQAALEPKL HHHHHHHHHHHHHHH | 23.66 | - | |
467 | Ubiquitination | EALEEQAALEPKLDL HHHHHHHHHHHHHHH | 16.50 | - | |
467 | Ubiquitination | EALEEQAALEPKLDL HHHHHHHHHHHHHHH | 16.50 | 33845483 | |
471 | Ubiquitination | EQAALEPKLDLLLEK HHHHHHHHHHHHHHH | 45.30 | 29967540 | |
475 | Ubiquitination | LEPKLDLLLEKTKEL HHHHHHHHHHHHHHH | 6.07 | 29967540 | |
476 | Ubiquitination | EPKLDLLLEKTKELQ HHHHHHHHHHHHHHH | 9.13 | - | |
476 | Ubiquitination | EPKLDLLLEKTKELQ HHHHHHHHHHHHHHH | 9.13 | 23503661 | |
478 | 2-Hydroxyisobutyrylation | KLDLLLEKTKELQKL HHHHHHHHHHHHHHH | 65.94 | - | |
478 | Ubiquitination | KLDLLLEKTKELQKL HHHHHHHHHHHHHHH | 65.94 | 33845483 | |
482 | Ubiquitination | LLEKTKELQKLIEAD HHHHHHHHHHHHHHH | 6.08 | - | |
482 | Ubiquitination | LLEKTKELQKLIEAD HHHHHHHHHHHHHHH | 6.08 | 23503661 | |
484 | Ubiquitination | EKTKELQKLIEADIS HHHHHHHHHHHHHHH | 65.15 | 29967540 | |
492 | 2-Hydroxyisobutyrylation | LIEADISKRYSGRPV HHHHHHHHHCCCCCC | 56.54 | - | |
492 | Ubiquitination | LIEADISKRYSGRPV HHHHHHHHHCCCCCC | 56.54 | 32015554 | |
494 | Phosphorylation | EADISKRYSGRPVNL HHHHHHHCCCCCCCC | 21.15 | 22461510 | |
496 | Ubiquitination | DISKRYSGRPVNLMG HHHHHCCCCCCCCCC | 29.04 | - | |
496 | Ubiquitination | DISKRYSGRPVNLMG HHHHHCCCCCCCCCC | 29.04 | 29967540 | |
503 | Ubiquitination | GRPVNLMGTSL---- CCCCCCCCCCC---- | 18.47 | - | |
503 | Ubiquitination | GRPVNLMGTSL---- CCCCCCCCCCC---- | 18.47 | 33845483 | |
504 | Phosphorylation | RPVNLMGTSL----- CCCCCCCCCC----- | 16.94 | 26471730 | |
505 | Phosphorylation | PVNLMGTSL------ CCCCCCCCC------ | 26.76 | 25850435 | |
509 | Ubiquitination | MGTSL---------- CCCCC---------- | 29967540 | ||
517 | Ubiquitination | ------------------ ------------------ | - | ||
517 | Ubiquitination | ------------------ ------------------ | 32015554 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CK5P3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CK5P3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CK5P3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...