| UniProt ID | LPD6B_HUMAN | |
|---|---|---|
| UniProt AC | Q8NI32 | |
| Protein Name | Ly6/PLAUR domain-containing protein 6B | |
| Gene Name | LYPD6B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 183 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
| Protein Description | Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro acts on nAChRs in a subtype- and stoichiometry-dependent manner. Modulates specifically alpha-3(3):beta-4(2) nAChRs by enhancing the sensitivity to ACh, decreasing ACh-induced maximal current response and increasing the rate of desensitization to ACh; has no effect on alpha-7 homomeric nAChRs; modulates alpha-3(2):alpha-5:beta-4(2) nAChRs in the context of CHRNA5/alpha-5 variant Asn-398 but not its wild-type sequence.. | |
| Protein Sequence | MLYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNSFKCFTCENAGDNYNCNRWAEDKWCPQNTQYCLTVHHFTSHGRSTSITKKCASRSECHFVGCHHSRDSEHTECRSCCEGMICNVELPTNHTNAVFAVMHAQRTSGSSAPTLYLPVLAWVFVLPLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 (in isoform 2) | Phosphorylation | - | 24.74 | 20639409 | |
| 7 (in isoform 2) | Phosphorylation | - | 68.61 | 20639409 | |
| 12 (in isoform 2) | Phosphorylation | - | 37.80 | 30266825 | |
| 17 (in isoform 2) | Phosphorylation | - | 3.43 | 27251275 | |
| 19 (in isoform 2) | Phosphorylation | - | 1.45 | 27251275 | |
| 20 (in isoform 2) | Phosphorylation | - | 24.60 | 27251275 | |
| 21 | Phosphorylation | SMLLLCHALAIAVVQ HHHHHHHHHHHHHHH | 9.55 | 27251275 | |
| 21 (in isoform 2) | Phosphorylation | - | 9.55 | 27251275 | |
| 164 | GPI-anchor | HAQRTSGSSAPTLYL ECHHCCCCCCCCCHH | 24.08 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LPD6B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LPD6B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LPD6B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of LPD6B_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
