dbPTM

CD5R1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CD5R1_HUMAN
UniProt AC	Q15078
Protein Name	Cyclin-dependent kinase 5 activator 1
Gene Name	CDK5R1
Organism	Homo sapiens (Human).
Sequence Length	307
Subcellular Localization	Cyclin-dependent kinase 5 activator 1, p35: Cell membrane Lipid-anchor Cytoplasmic side . In the primary cortical neurons, p35 is present in the peripheries and nerve terminals. Cyclin-dependent kinase 5 activator 1, p25: Nucleus. Cytoplasm, per
Protein Description	p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution..
Protein Sequence	MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	N-myristoyl glycine	------MGTVLSLSP ------CCCEEECCH	25.24	-
2	Myristoylation	------MGTVLSLSP ------CCCEEECCH	25.24	20213681
3	Phosphorylation	-----MGTVLSLSPS -----CCCEEECCHH	19.58	29759185
6	Phosphorylation	--MGTVLSLSPSYRK --CCCEEECCHHHCC	23.59	29759185
8	Phosphorylation	MGTVLSLSPSYRKAT CCCEEECCHHHCCEE	14.39	17121855
10	Phosphorylation	TVLSLSPSYRKATLF CEEECCHHHCCEEEE	33.91	29759185
91	Phosphorylation	ENLKKSLSCANLSTF CHHHHHHCCCCHHHC	20.48	20097924
134	Phosphorylation	KAPHPAVTSAGTPKR CCCCCCCCCCCCCCE	18.24	27732954
135	Phosphorylation	APHPAVTSAGTPKRV CCCCCCCCCCCCCEE	20.36	27732954
138	Phosphorylation	PAVTSAGTPKRVIVQ CCCCCCCCCCEEEEE	25.92	18507738
234	Phosphorylation	LTCLYLSYSYMGNEI HHHHHHHHHHCCCCC	10.96	-
263	Phosphorylation	AFWDRCLSVINLMSS HHHHHHHHHHHHHHC	25.28	29759185
269	Phosphorylation	LSVINLMSSKMLQIN HHHHHHHHCCCCCCC	29.94	29759185

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
8	S	Phosphorylation	Kinase	CDK5	Q00535	Uniprot
8	S	Phosphorylation	Kinase	CDK5	P49615	PSP
91	S	Phosphorylation	Kinase	SIK2	Q9H0K1	GPS
138	T	Phosphorylation	Kinase	CDK5	Q00535	Uniprot
138	T	Phosphorylation	Kinase	CDK5	P49615	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
8	S	Phosphorylation	17121855
Phosphorylation at Ser-8 and Thr-138 by CDK5 prevents calpain-mediated proteolysis.
138	T	Phosphorylation	17121855
Phosphorylation at Ser-8 and Thr-138 by CDK5 prevents calpain-mediated proteolysis.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CD5R1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
T22D4_HUMAN	TSC22D4	physical	16189514
CK5P2_HUMAN	CDK5RAP2	physical	10915792
KCC2A_HUMAN	CAMK2A	physical	12223541
ACTN1_HUMAN	ACTN1	physical	12223541
CTNB1_HUMAN	CTNNB1	physical	11168528
SDS3_MOUSE	Suds3	physical	15489224
NEST_HUMAN	NES	physical	17036052
CDK5_HUMAN	CDK5	physical	17036052
HS90A_HUMAN	HSP90AA1	physical	20618441
ODFP1_HUMAN	ODF1	physical	17762160
A4_HUMAN	APP	physical	21832049
MTUS2_HUMAN	MTUS2	physical	25416956
BL1S6_HUMAN	BLOC1S6	physical	25416956
K1C40_HUMAN	KRT40	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956
TAU_HUMAN	MAPT	physical	19527721
CDK2_HUMAN	CDK2	physical	26186194
UBE2T_HUMAN	UBE2T	physical	26186194
TPM2_HUMAN	TPM2	physical	26186194
CDK5_HUMAN	CDK5	physical	26186194
DENR_HUMAN	DENR	physical	26186194
PLPHP_HUMAN	PROSC	physical	26186194
HMCS1_HUMAN	HMGCS1	physical	26186194
CDK5_HUMAN	CDK5	physical	28514442
CDK2_HUMAN	CDK2	physical	28514442
TPM2_HUMAN	TPM2	physical	28514442
PLPHP_HUMAN	PROSC	physical	28514442
MB12A_HUMAN	MVB12A	physical	28514442
DENR_HUMAN	DENR	physical	28514442
UBE2T_HUMAN	UBE2T	physical	28514442
HMCS1_HUMAN	HMGCS1	physical	28514442
MMAB_HUMAN	MMAB	physical	28514442
RSPRY_HUMAN	RSPRY1	physical	28514442
UBXN1_HUMAN	UBXN1	physical	28514442

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CD5R1_HUMAN

Related Literatures of Post-Translational Modification

Myristoylation
Reference	PubMed
"Strategy for comprehensive identification of human N-myristoylatedproteins using an insect cell-free protein synthesis system."; Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E.,Tsunasawa S., Utsumi T.; Proteomics 10:1780-1793(2010). Cited for: MYRISTOYLATION AT GLY-2.	20213681 [Abstract]
"Myristoylation of p39 and p35 is a determinant of cytoplasmic ornuclear localization of active cyclin-dependent kinase 5 complexes."; Asada A., Yamamoto N., Gohda M., Saito T., Hayashi N., Hisanaga S.; J. Neurochem. 106:1325-1336(2008). Cited for: SUBCELLULAR LOCATION, MYRISTOYLATION, AND MUTAGENESIS OF GLY-2.	18507738 [Abstract]
Phosphorylation
Reference	PubMed
"Suppression of calpain-dependent cleavage of the CDK5 activator p35to p25 by site-specific phosphorylation."; Kamei H., Saito T., Ozawa M., Fujita Y., Asada A., Bibb J.A.,Saido T.C., Sorimachi H., Hisanaga S.; J. Biol. Chem. 282:1687-1694(2007). Cited for: PHOSPHORYLATION AT SER-8 AND THR-138, AND MUTAGENESIS OF SER-8 ANDTHR-138.	17121855 [Abstract]