SIVA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SIVA_HUMAN
• UniProt AC: O15304
• Protein Name: Apoptosis regulatory protein Siva
• Gene Name: SIVA1
• Organism: Homo sapiens (Human).
• Sequence Length: 175
• Subcellular Localization: Cytoplasm . Nucleus . In the nucleus, accumulates in dot-like structures.
• Protein Description: Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis..
• Protein Sequence: MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MPKRSCPFADVA ---CCCCCCCCCCCC	32.06	25159151
17	Ubiquitination	DVAPLQLKVRVSQRE CCCCCEEEEEEHHHH	18.29	21963094
17 (in isoform 1)	Ubiquitination	-	18.29	21890473
31 (in isoform 2)	Ubiquitination	-	11.25	21890473
34	Phosphorylation	RGVCAERYSQEVFEK CCCCHHHHCHHHHHH	13.25	11278261
41	Ubiquitination	YSQEVFEKTKRLLFL HCHHHHHHHHHHHHH	48.13	22817900
41 (in isoform 1)	Ubiquitination	-	48.13	21890473
43	Ubiquitination	QEVFEKTKRLLFLGA HHHHHHHHHHHHHHH	52.71	22817900
53	Phosphorylation	LFLGAQAYLDHVWDE HHHHHHHHHHHHCCC	10.69	20727854
59	Ubiquitination	AYLDHVWDEGCAVVH HHHHHHCCCCEEEEE	41.12	33845483
70	Phosphorylation	AVVHLPESPKPGPTG EEEECCCCCCCCCCC	35.96	22617229
76	Phosphorylation	ESPKPGPTGAPRAAR CCCCCCCCCCCCCCC	52.47	27251275
124	Ubiquitination	CVRAVDGKAVCGQCE CEEECCCCEECCCCH	32.93	33845483
162	Phosphorylation	LVDCSDMYEKVLCTS CCCCHHHHHHHHCHH	20.00	20727854

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
34	Y	Phosphorylation	Kinase	ARG	P42684	PSP
53	Y	Phosphorylation	Kinase	TYK2	P29597	PSP
162	Y	Phosphorylation	Kinase	TYK2	P29597	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SIVA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SIVA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LPAR2_HUMAN	LPAR2	physical	19293149
PXMP2_HUMAN	PXMP2	physical	16683188
P53_HUMAN	TP53	physical	19590512
MDM2_HUMAN	MDM2	physical	19590512
XIAP_HUMAN	XIAP	physical	19584092
A4_HUMAN	APP	physical	21832049
CDN2A_HUMAN	CDKN2A	physical	23462994
ARF_HUMAN	CDKN2A	physical	23462994
UB2D1_HUMAN	UBE2D1	physical	23462994
TA2R_HUMAN	TBXA2R	physical	22343716
PCNA_HUMAN	PCNA	physical	24958773
RAD18_HUMAN	RAD18	physical	24958773
TYK2_HUMAN	TYK2	physical	20727854
CD4_HUMAN	CD4	physical	17653867
TELT_HUMAN	TCAP	physical	18849585
STMN1_HUMAN	STMN1	physical	21768358
KCC2G_HUMAN	CAMK2G	physical	21768358
P53_HUMAN	TP53	physical	25431847

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"The ARG tyrosine kinase interacts with Siva-1 in the apoptoticresponse to oxidative stress.";
Cao C., Ren X., Kharbanda S., Koleske A., Prasad K.V.S., Kufe D.;
J. Biol. Chem. 276:11465-11468(2001).
Cited for: PHOSPHORYLATION AT TYR-34, AND MUTAGENESIS OF TYR-34 AND TYR-53.
PubMed: 11278261