UniProt ID | PXMP2_HUMAN | |
---|---|---|
UniProt AC | Q9NR77 | |
Protein Name | Peroxisomal membrane protein 2 | |
Gene Name | PXMP2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 195 | |
Subcellular Localization |
Peroxisome membrane Multi-pass membrane protein. |
|
Protein Description | Seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the peroxisomal membrane.. | |
Protein Sequence | MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLASLGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Phosphorylation | KKRKKENSRSLDVGG HHHHHHCCCCCCCCC | 25.08 | 29116813 | |
66 | Phosphorylation | RKKENSRSLDVGGPL HHHHCCCCCCCCCCH | 28.83 | 23312004 | |
160 | Phosphorylation | RMNWRVWTPLQFINI HCCEEEECCEEEEEC | 15.97 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PXMP2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PXMP2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PXMP2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PEX19_HUMAN | PEX19 | physical | 11590176 | |
K1C40_HUMAN | KRT40 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...