UniProt ID | RU2B_HUMAN | |
---|---|---|
UniProt AC | P08579 | |
Protein Name | U2 small nuclear ribonucleoprotein B'' | |
Gene Name | SNRPB2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 225 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in pre-mRNA splicing as component of the spliceosome. [PubMed: 11991638] | |
Protein Sequence | MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Ubiquitination | YINNMNDKIKKEELK EECCCCHHHCHHHHH | 51.96 | - | |
20 | Ubiquitination | NMNDKIKKEELKRSL CCCHHHCHHHHHHHH | 60.95 | 24816145 | |
57 | Acetylation | GQAFVIFKELGSSTN CCEEEEEECCCCCHH | 40.69 | 26051181 | |
57 | Ubiquitination | GQAFVIFKELGSSTN CCEEEEEECCCCCHH | 40.69 | 23000965 | |
77 | Ubiquitination | QGFPFYGKPMRIQYA CCCCCCCCCCEEEEE | 25.02 | 23000965 | |
85 | Acetylation | PMRIQYAKTDSDIIS CCEEEEEECCHHHHH | 48.18 | 25953088 | |
85 | Ubiquitination | PMRIQYAKTDSDIIS CCEEEEEECCHHHHH | 48.18 | 21906983 | |
86 | O-linked_Glycosylation | MRIQYAKTDSDIISK CEEEEEECCHHHHHH | 32.34 | 29351928 | |
93 | Ubiquitination | TDSDIISKMRGTFAD CCHHHHHHHHCCCCC | 23.39 | 27667366 | |
93 | Acetylation | TDSDIISKMRGTFAD CCHHHHHHHHCCCCC | 23.39 | 25953088 | |
101 | Acetylation | MRGTFADKEKKKEKK HHCCCCCHHHHHHHH | 68.92 | 26051181 | |
111 | Ubiquitination | KKEKKKAKTVEQTAT HHHHHHCCCCEECCC | 63.08 | 33845483 | |
111 | Sumoylation | KKEKKKAKTVEQTAT HHHHHHCCCCEECCC | 63.08 | 28112733 | |
111 | Acetylation | KKEKKKAKTVEQTAT HHHHHHCCCCEECCC | 63.08 | - | |
112 | Phosphorylation | KEKKKAKTVEQTATT HHHHHCCCCEECCCC | 33.85 | 23312004 | |
116 | Phosphorylation | KAKTVEQTATTTNKK HCCCCEECCCCCCCC | 16.68 | 28102081 | |
118 | Phosphorylation | KTVEQTATTTNKKPG CCCEECCCCCCCCCC | 37.22 | 28102081 | |
119 | Phosphorylation | TVEQTATTTNKKPGQ CCEECCCCCCCCCCC | 26.38 | 28102081 | |
120 | Phosphorylation | VEQTATTTNKKPGQG CEECCCCCCCCCCCC | 40.46 | 28102081 | |
122 | Ubiquitination | QTATTTNKKPGQGTP ECCCCCCCCCCCCCC | 59.25 | 27667366 | |
128 | Phosphorylation | NKKPGQGTPNSANTQ CCCCCCCCCCCCCCC | 16.06 | - | |
151 | Phosphorylation | VPDYPPNYILFLNNL CCCCCCCEEEEECCC | 12.55 | 28112733 | |
211 | Ubiquitination | RDALQGFKITPSHAM HHHHCCCCCCHHHCC | 53.12 | 32015554 | |
211 | Acetylation | RDALQGFKITPSHAM HHHHCCCCCCHHHCC | 53.12 | 25953088 | |
213 | Phosphorylation | ALQGFKITPSHAMKI HHCCCCCCHHHCCEE | 21.23 | 20068231 | |
215 | Phosphorylation | QGFKITPSHAMKITY CCCCCCHHHCCEEEE | 18.41 | 23186163 | |
219 | Ubiquitination | ITPSHAMKITYAKK- CCHHHCCEEEEECC- | 32.45 | 23000965 | |
219 | Malonylation | ITPSHAMKITYAKK- CCHHHCCEEEEECC- | 32.45 | 26320211 | |
219 | Acetylation | ITPSHAMKITYAKK- CCHHHCCEEEEECC- | 32.45 | 25953088 | |
221 | Phosphorylation | PSHAMKITYAKK--- HHHCCEEEEECC--- | 16.35 | 29083192 | |
222 | Phosphorylation | SHAMKITYAKK---- HHCCEEEEECC---- | 21.64 | 29083192 | |
224 | Ubiquitination | AMKITYAKK------ CCEEEEECC------ | 48.91 | 23000965 | |
225 | Ubiquitination | MKITYAKK------- CEEEEECC------- | 58.35 | 23000965 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RU2B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RU2B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RU2B_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells."; Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.; Nat. Biotechnol. 23:94-101(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-151, AND MASSSPECTROMETRY. |