UniProt ID | PCAT1_HUMAN | |
---|---|---|
UniProt AC | Q8NF37 | |
Protein Name | Lysophosphatidylcholine acyltransferase 1 | |
Gene Name | LPCAT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 534 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type II membrane protein . Golgi apparatus membrane Single-pass type II membrane protein . Lipid droplet . May adopt a monotopic topology when embedded in the lipid monolayer of the lipid droplet, with b |
|
Protein Description | Possesses both acyltransferase and acetyltransferase activities. [PubMed: 16864775] | |
Protein Sequence | MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | GPRAAPASSAGASDA CCCCCCCCCCCCCCC | 21.47 | 29396449 | |
15 | Phosphorylation | PRAAPASSAGASDAR CCCCCCCCCCCCCCE | 32.59 | 29396449 | |
19 | Phosphorylation | PASSAGASDARLLAP CCCCCCCCCCEECCC | 30.77 | 29396449 | |
39 | Phosphorylation | FVHELRLSALQKAQV CHHHHHHHHHHHHHH | 22.09 | 20860994 | |
50 | Phosphorylation | KAQVALMTLTLFPVR HHHHHHHHHCHHHHH | 19.90 | 20860994 | |
52 | Phosphorylation | QVALMTLTLFPVRLL HHHHHHHCHHHHHHH | 19.72 | - | |
93 | Ubiquitination | QPPALWRKVVDFLLK CCCHHHHHHHHHHHH | 34.72 | - | |
191 | Ubiquitination | RKTVEEIKRRAQSNG HHHHHHHHHHHHHCC | 38.83 | - | |
199 | Ubiquitination | RRAQSNGKWPQIMIF HHHHHCCCCCEEEEE | 61.01 | - | |
216 | S-palmitoylation | GTCTNRTCLITFKPG CCCCCCEEEEEECCC | 2.03 | 29575903 | |
221 | Acetylation | RTCLITFKPGAFIPG CEEEEEECCCCCCCC | 33.61 | 26051181 | |
221 | Ubiquitination | RTCLITFKPGAFIPG CEEEEEECCCCCCCC | 33.61 | - | |
292 | Phosphorylation | RNPALYASNVRRVMA CCHHHHHHHHHHHHH | 23.46 | - | |
330 | Glutathionylation | LRLPADTCLLEFARL CCCCHHHHHHHHHHH | 4.14 | 22555962 | |
344 | Ubiquitination | LVRGLGLKPEKLEKD HHHHCCCCHHHHHHH | 49.70 | - | |
347 | Ubiquitination | GLGLKPEKLEKDLDR HCCCCHHHHHHHHHH | 71.16 | - | |
362 | Ubiquitination | YSERARMKGGEKIGI HHHHHHHCCCCEEEH | 59.20 | - | |
381 | Phosphorylation | ASLEVPVSDLLEDMF HHCCCCHHHHHHHHH | 19.23 | 22210691 | |
381 | O-linked_Glycosylation | ASLEVPVSDLLEDMF HHCCCCHHHHHHHHH | 19.23 | 29351928 | |
394 | Phosphorylation | MFSLFDESGSGEVDL HHHHHCCCCCCCCCH | 39.85 | 22210691 | |
396 | Phosphorylation | SLFDESGSGEVDLRE HHHCCCCCCCCCHHH | 40.85 | 22210691 | |
409 | O-linked_Glycosylation | RECVVALSVVCRPAR HHHHHHHHHHCCCCC | 11.63 | 29351928 | |
443 | Glutathionylation | VGEGDLSCILKTALG CCCCHHHHHHHHHHC | 5.70 | 22555962 | |
447 | Phosphorylation | DLSCILKTALGVAEL HHHHHHHHHHCCEEE | 24.54 | 20860994 | |
470 | 2-Hydroxyisobutyrylation | IDQEEKGKITFADFH CCHHHCCCCCHHHHH | 50.03 | - | |
470 | Ubiquitination | IDQEEKGKITFADFH CCHHHCCCCCHHHHH | 50.03 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PCAT1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PCAT1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BBS2_HUMAN | BBS2 | physical | 26186194 | |
MSTO1_HUMAN | MSTO1 | physical | 26186194 | |
S27A2_HUMAN | SLC27A2 | physical | 26186194 | |
DOCK7_HUMAN | DOCK7 | physical | 26186194 | |
DIP2A_HUMAN | DIP2A | physical | 26186194 | |
FBW1A_HUMAN | BTRC | physical | 21068446 | |
S27A2_HUMAN | SLC27A2 | physical | 28514442 | |
MSTO1_HUMAN | MSTO1 | physical | 28514442 | |
METH_HUMAN | MTR | physical | 28514442 | |
DIP2A_HUMAN | DIP2A | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...