dbPTM

MSTO1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MSTO1_HUMAN
UniProt AC	Q9BUK6
Protein Name	Protein misato homolog 1
Gene Name	MSTO1
Organism	Homo sapiens (Human).
Sequence Length	570
Subcellular Localization	Mitochondrion outer membrane . Cytoplasm .
Protein Description	Involved in the regulation of mitochondrial distribution and morphology. [PubMed: 17349998]
Protein Sequence	MAGGAREVLTLQLGHFAGFVGAHWWNQQDAALGRATDSKEPPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKAAELLQDEYSGRGIITWGLLPGPYHRGEAQRNIYRLLNTAFGLVHLTAHSSLVCPLSLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRLCSSPVSMVHLADMLSFCGKKVVTAGAIIPFPLAPGQSLPDSLMQFGGATPWTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSALHACTTGEEILAQYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPGMVLDGSPKGAAVESIPVFGALCSSSSLHQTLEALARDLTKLDLRRWASFMDAGVEHDDVAELLQELQSLAQCYQGGDSLVD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Ubiquitination	HFAGFVGAHWWNQQD HHHHHCCHHHHCHHH	6.99	27667366
25	Ubiquitination	GFVGAHWWNQQDAAL HHCCHHHHCHHHHHH	5.27	27667366
26	Ubiquitination	FVGAHWWNQQDAALG HCCHHHHCHHHHHHC	25.17	27667366
28	Ubiquitination	GAHWWNQQDAALGRA CHHHHCHHHHHHCCC	38.81	22817900
29	Ubiquitination	AHWWNQQDAALGRAT HHHHCHHHHHHCCCC	24.84	22817900
39	Ubiquitination	LGRATDSKEPPGELC HCCCCCCCCCCCCCC	76.64	21963094
56	Phosphorylation	VLYRTGRTLHGQETY HHHHCCCCCCCCCCC	25.17	29083192
62	Phosphorylation	RTLHGQETYTPRLIL CCCCCCCCCCCEEEE	25.47	29083192
63	Phosphorylation	TLHGQETYTPRLILM CCCCCCCCCCEEEEE	17.62	27642862
64	Phosphorylation	LHGQETYTPRLILMD CCCCCCCCCEEEEEE	14.89	29083192
73	Ubiquitination	RLILMDLKGSLSSLK EEEEEECCCCHHHHH	42.04	21963094
77	Phosphorylation	MDLKGSLSSLKEEGG EECCCCHHHHHHHCC	35.01	24719451
79	Ubiquitination	LKGSLSSLKEEGGLY CCCCHHHHHHHCCCC	7.91	27667366
80	Ubiquitination	KGSLSSLKEEGGLYR CCCHHHHHHHCCCCC	56.52	21906983
80 (in isoform 1)	Ubiquitination	-	56.52	21890473
80 (in isoform 2)	Ubiquitination	-	56.52	21890473
80 (in isoform 3)	Ubiquitination	-	56.52	21890473
80 (in isoform 4)	Ubiquitination	-	56.52	21906983
80 (in isoform 7)	Ubiquitination	-	56.52	21890473
89	Ubiquitination	EGGLYRDKQLDAAIA HCCCCCCHHHCHHEE	43.70	23000965
89 (in isoform 1)	Ubiquitination	-	43.70	21890473
89 (in isoform 2)	Ubiquitination	-	43.70	21890473
89 (in isoform 3)	Ubiquitination	-	43.70	21890473
89 (in isoform 4)	Ubiquitination	-	43.70	21906983
89 (in isoform 7)	Ubiquitination	-	43.70	21890473
100	Ubiquitination	AAIAWQGKLTTHKEE HHEEECCCCCCCHHH	27.79	22817900
100 (in isoform 2)	Ubiquitination	-	27.79	-
105	Ubiquitination	QGKLTTHKEELYPKN CCCCCCCHHHHCCCC	51.28	21906983
105 (in isoform 1)	Ubiquitination	-	51.28	21890473
105 (in isoform 2)	Ubiquitination	-	51.28	21890473
105 (in isoform 3)	Ubiquitination	-	51.28	21890473
105 (in isoform 4)	Ubiquitination	-	51.28	21906983
107 (in isoform 7)	Phosphorylation	-	59.41	27762562
108 (in isoform 7)	Phosphorylation	-	10.46	27762562
111	Ubiquitination	HKEELYPKNPYLQDF CHHHHCCCCHHHHHH	57.93	23503661
127	Ubiquitination	SAEGVLSSDGVWRVK HCCCCCCCCCEEEEE	33.93	21963094
134	Ubiquitination	SDGVWRVKSIPNGKG CCCEEEEEECCCCCC	33.81	27667366
135	Phosphorylation	DGVWRVKSIPNGKGS CCEEEEEECCCCCCC	40.18	23312004
137	Ubiquitination	VWRVKSIPNGKGSSP EEEEEECCCCCCCCC	51.08	21963094
138	Ubiquitination	WRVKSIPNGKGSSPL EEEEECCCCCCCCCC	64.24	22817900
140	Ubiquitination	VKSIPNGKGSSPLPT EEECCCCCCCCCCCC	63.36	-
141 (in isoform 6)	Ubiquitination	-	34.45	21890473
142	Phosphorylation	SIPNGKGSSPLPTAT ECCCCCCCCCCCCCC	32.06	23401153
143	Phosphorylation	IPNGKGSSPLPTATT CCCCCCCCCCCCCCC	38.84	22167270
147	Phosphorylation	KGSSPLPTATTPKPL CCCCCCCCCCCCCCC	44.30	25159151
148	Ubiquitination	GSSPLPTATTPKPLI CCCCCCCCCCCCCCC	13.92	27667366
148 (in isoform 5)	Ubiquitination	-	13.92	21890473
149	Phosphorylation	SSPLPTATTPKPLIP CCCCCCCCCCCCCCC	46.22	26055452
150	Phosphorylation	SPLPTATTPKPLIPT CCCCCCCCCCCCCCC	27.18	25159151
151	Ubiquitination	PLPTATTPKPLIPTE CCCCCCCCCCCCCCH	31.73	22817900
151 (in isoform 5)	Ubiquitination	-	31.73	21890473
152	Ubiquitination	LPTATTPKPLIPTEA CCCCCCCCCCCCCHH	50.82	29967540
157	Phosphorylation	TPKPLIPTEASIRVW CCCCCCCCHHHHHHH	36.87	28857561
160	Phosphorylation	PLIPTEASIRVWSDF CCCCCHHHHHHHHCE	12.51	23186163
168 (in isoform 7)	Ubiquitination	-	7.21	21890473
171 (in isoform 7)	Ubiquitination	-	16.40	21890473
182	Ubiquitination	RSICMIQKYNHDGEA CCEEEEEEECCCCCC	36.78	21963094
184	Ubiquitination	ICMIQKYNHDGEAGR EEEEEEECCCCCCCC	33.53	21963094
185	Ubiquitination	CMIQKYNHDGEAGRL EEEEEECCCCCCCCE	41.17	22817900
187	Ubiquitination	IQKYNHDGEAGRLEA EEEECCCCCCCCEEE	21.07	21963094
188	Ubiquitination	QKYNHDGEAGRLEAF EEECCCCCCCCEEEE	54.75	21963094
189	Ubiquitination	KYNHDGEAGRLEAFG EECCCCCCCCEEEEC	17.59	22817900
200	Phosphorylation	EAFGQGESVLKEPKY EEECCCCCHHCCCCH	39.30	21406692
203	Ubiquitination	GQGESVLKEPKYQEE CCCCCHHCCCCHHHH	70.57	21906983
203 (in isoform 1)	Ubiquitination	-	70.57	21890473
203 (in isoform 2)	Ubiquitination	-	70.57	21890473
203 (in isoform 3)	Ubiquitination	-	70.57	21890473
206	Ubiquitination	ESVLKEPKYQEELED CCHHCCCCHHHHHHH	61.73	21906983
206 (in isoform 1)	Ubiquitination	-	61.73	21890473
206 (in isoform 2)	Ubiquitination	-	61.73	21890473
206 (in isoform 3)	Ubiquitination	-	61.73	21890473
207	Phosphorylation	SVLKEPKYQEELEDR CHHCCCCHHHHHHHH	31.69	27642862
278	Phosphorylation	GEAQRNIYRLLNTAF HHHHHHHHHHHHHHH	9.96	-
300 (in isoform 5)	Phosphorylation	-	5.81	22210691
301	Ubiquitination	SSLVCPLSLGGSLGL CCCEEEHHHCCCCCC	15.31	21890473
310	Ubiquitination	GGSLGLRPEPPVSFP CCCCCCCCCCCCCCC	64.59	21963094
311	Ubiquitination	GSLGLRPEPPVSFPY CCCCCCCCCCCCCCC	56.66	22817900
314	Ubiquitination	GLRPEPPVSFPYLHY CCCCCCCCCCCCCCC	15.67	21963094
315	Ubiquitination	LRPEPPVSFPYLHYD CCCCCCCCCCCCCCC	26.69	22817900
317 (in isoform 5)	Phosphorylation	-	24.22	29116813
337	Ubiquitination	SAILATALDTVTVPY HHHHHHHHCCCCCCH	5.01	21890473
348	Ubiquitination	TVPYRLCSSPVSMVH CCCHHHCCCCCCHHH	42.12	21890473
350	Ubiquitination	PYRLCSSPVSMVHLA CHHHCCCCCCHHHHH	13.10	21890473
351	Ubiquitination	YRLCSSPVSMVHLAD HHHCCCCCCHHHHHH	6.61	21890473
352	Ubiquitination	RLCSSPVSMVHLADM HHCCCCCCHHHHHHH	20.62	21890473
365	Ubiquitination	DMLSFCGKKVVTAGA HHHHHCCCEEEEECE	43.50	21963094
366	Ubiquitination	MLSFCGKKVVTAGAI HHHHCCCEEEEECEE	27.50	22817900
415	Phosphorylation	GTRCFAQSVVLRGID CCCCCHHHHHHCCCC	15.68	28857561
419	Methylation	FAQSVVLRGIDRACH CHHHHHHCCCCHHCC	28.54	115483905
434	Phosphorylation	TSQLTPGTPPPSALH CCCCCCCCCCCHHHH	33.55	22468782
438	Phosphorylation	TPGTPPPSALHACTT CCCCCCCHHHHHCCC	49.60	28348404
453	Phosphorylation	GEEILAQYLQQQQPG HHHHHHHHHHHCCCC	10.81	28348404
474	Ubiquitination	LLLTPCRVAPPYPHL EEEECCCCCCCCCCC	13.78	21890473
478	Phosphorylation	PCRVAPPYPHLFSSC CCCCCCCCCCCCCCC	11.39	27134283
478	Ubiquitination	PCRVAPPYPHLFSSC CCCCCCCCCCCCCCC	11.39	21890473
478 (in isoform 2)	Phosphorylation	-	11.39	22210691
483	Phosphorylation	PPYPHLFSSCSPPGM CCCCCCCCCCCCCCC	36.47	26074081
483 (in isoform 7)	Ubiquitination	-	36.47	21890473
484	Phosphorylation	PYPHLFSSCSPPGMV CCCCCCCCCCCCCCE	15.98	26074081
486	Phosphorylation	PHLFSSCSPPGMVLD CCCCCCCCCCCCEEC	35.76	26074081
495	Phosphorylation	PGMVLDGSPKGAAVE CCCEECCCCCCCCCC	24.09	30278072
495 (in isoform 2)	Phosphorylation	-	24.09	29116813
517	Ubiquitination	LCSSSSLHQTLEALA HHCCCHHHHHHHHHH	22.11	21890473
517 (in isoform 3)	Ubiquitination	-	22.11	21890473
518	Ubiquitination	CSSSSLHQTLEALAR HCCCHHHHHHHHHHH	53.74	21890473
528	Ubiquitination	EALARDLTKLDLRRW HHHHHHHHHHHHHHH	33.57	21890473
528 (in isoform 2)	Ubiquitination	-	33.57	21890473
529	Ubiquitination	ALARDLTKLDLRRWA HHHHHHHHHHHHHHH	47.50	22817900
529 (in isoform 1)	Ubiquitination	-	47.50	21890473

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MSTO1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MSTO1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MSTO1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
NR1H3_HUMAN	NR1H3	physical	21988832

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MSTO1_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-143, AND MASSSPECTROMETRY.	19413330 [Abstract]
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-495, AND MASSSPECTROMETRY.	18669648 [Abstract]