UniProt ID | MPV17_HUMAN | |
---|---|---|
UniProt AC | P39210 | |
Protein Name | Protein Mpv17 | |
Gene Name | MPV17 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 176 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.. | |
Protein Sequence | MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | PWKVQVLTAGSLMGL CCEEEEEEHHHHCCH | 30.07 | 24043423 | |
25 | Phosphorylation | VQVLTAGSLMGLGDI EEEEEHHHHCCHHHH | 16.84 | 24043423 | |
34 | Phosphorylation | MGLGDIISQQLVERR CCHHHHHHHHHHHHC | 16.53 | 24043423 | |
80 | Phosphorylation | LDRFIPGTTKVDALK HHHHCCCCCHHHHHH | 20.35 | - | |
82 | Ubiquitination | RFIPGTTKVDALKKM HHCCCCCHHHHHHHH | 37.65 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPV17_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MPV17_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPV17_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...