| UniProt ID | CCD12_HUMAN | |
|---|---|---|
| UniProt AC | Q8WUD4 | |
| Protein Name | Coiled-coil domain-containing protein 12 | |
| Gene Name | CCDC12 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 166 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEATTAGV -------CCCCCCCC | 7.74 | 22814378 | |
| 53 | Acetylation | EEEEEGEKHRELRLR HHHHHHHHHHHHHHH | 59.84 | - | |
| 62 | Phosphorylation | RELRLRNYVPEDEDL HHHHHHHCCCCCHHH | 15.79 | 28674419 | |
| 78 | Acetylation | KRRVPQAKPVAVEEK HCCCCCCCCCCHHHH | 34.47 | 23749302 | |
| 85 | Sumoylation | KPVAVEEKVKEQLEA CCCCHHHHHHHHHHH | 45.13 | - | |
| 85 | Sumoylation | KPVAVEEKVKEQLEA CCCCHHHHHHHHHHH | 45.13 | - | |
| 94 | Sumoylation | KEQLEAAKPEPVIEE HHHHHHCCCCCCEEH | 57.89 | - | |
| 94 | Ubiquitination | KEQLEAAKPEPVIEE HHHHHHCCCCCCEEH | 57.89 | - | |
| 94 | Sumoylation | KEQLEAAKPEPVIEE HHHHHHCCCCCCEEH | 57.89 | 28112733 | |
| 111 | Ubiquitination | LANLAPRKPDWDLKR HHHCCCCCCCCCHHH | 46.39 | - | |
| 129 | Acetylation | KKLEKLKKRTQRAIA HHHHHHHHHHHHHHH | 71.73 | 7226449 | |
| 144 | Ubiquitination | ELIRERLKGQEDSLA HHHHHHHCCCCCHHH | 65.84 | - | |
| 149 | Phosphorylation | RLKGQEDSLASAVDA HHCCCCCHHHHHHHH | 25.69 | 23401153 | |
| 152 | Phosphorylation | GQEDSLASAVDAATE CCCCHHHHHHHHHHH | 33.83 | 30266825 | |
| 158 | Phosphorylation | ASAVDAATEQKTCDS HHHHHHHHHHHCCCC | 40.44 | 30266825 | |
| 162 | Phosphorylation | DAATEQKTCDSD--- HHHHHHHCCCCC--- | 22.65 | 30266825 | |
| 165 | Phosphorylation | TEQKTCDSD------ HHHHCCCCC------ | 47.57 | 23401153 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCD12_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCD12_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCD12_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CRNL1_HUMAN | CRNKL1 | physical | 22365833 | |
| CHM4C_HUMAN | CHMP4C | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-165, AND MASS SPECTROMETRY. | |
| Phosphorylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-165, AND MASS SPECTROMETRY. | |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-165, AND MASSSPECTROMETRY. | |