CHM4C_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CHM4C_HUMAN
• UniProt AC: Q96CF2
• Protein Name: Charged multivesicular body protein 4c
• Gene Name: CHMP4C
• Organism: Homo sapiens (Human).
• Sequence Length: 233
• Subcellular Localization: Cytoplasm, cytosol. Late endosome membrane ; Peripheral membrane protein . Midbody, Midbody ring . Localizes to the midbody during late cytokinesis. During its recruitment, localizes initially to the midbody arms, before being directed to the central
• Protein Description: Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). Key component of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature resolution of intercellular chromosome bridges and accumulation of DNA damage: upon phosphorylation by AURKB, together with ZFYVE19/ANCHR, retains abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. Deactivation of AURKB results in dephosphorylation of CHMP4C followed by its dissociation from ANCHR and VPS4 and subsequent abscission. [PubMed: 22422861]
• Protein Sequence: MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	KFFKGGGSSKSRAAP CCCCCCCCCCCCCCC	37.56	26434776
14	Phosphorylation	FFKGGGSSKSRAAPS CCCCCCCCCCCCCCC	37.61	24719451
16	Phosphorylation	KGGGSSKSRAAPSPQ CCCCCCCCCCCCCHH	29.15	23403867
21	Phosphorylation	SKSRAAPSPQEALVR CCCCCCCCHHHHHHH	34.19	23403867
70	Ubiquitination	RAALQALKRKKRFEK HHHHHHHHHHHHHHH	66.25	32015554
80	Phosphorylation	KRFEKQLTQIDGTLS HHHHHHHHHCCCCHH	22.45	27251275
146	Phosphorylation	QDIAQEISEAFSQRV HHHHHHHHHHHHHHH	23.32	20058876
190	Phosphorylation	IRLPNVPSSSLPAQP CCCCCCCHHHCCCCC	28.42	26657352
191	Phosphorylation	RLPNVPSSSLPAQPN CCCCCCHHHCCCCCC	29.80	28857561
192	Phosphorylation	LPNVPSSSLPAQPNR CCCCCHHHCCCCCCC	42.59	28857561
204	Phosphorylation	PNRKPGMSSTARRSR CCCCCCCCHHHHHHH	30.38	22210691
210	Phosphorylation	MSSTARRSRAASSQR CCHHHHHHHHHHHHH	22.25	22422861
214	Phosphorylation	ARRSRAASSQRAEEE HHHHHHHHHHHHHHC	26.47	27273156
215	Phosphorylation	RRSRAASSQRAEEED HHHHHHHHHHHHHCC	20.96	27273156
233	Phosphorylation	KQLAAWAT------- HHHHHHHC-------	28.57	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
210	S	Phosphorylation	Kinase	AURB	Q96GD4	PSP
214	S	Phosphorylation	Kinase	AURKB	Q96GD4	GPS
215	S	Phosphorylation	Kinase	AURKB	Q96GD4	GPS

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
210	S	Phosphorylation	Phosphorylated at Ser-210 by AURKB during cytokinesis: together with ZFYVE19/ANCHR, phosphorylated CHMP4C retains abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis.	22422861

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CHM4C_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PDC6I_HUMAN	PDCD6IP	physical	14505570
CHM4A_HUMAN	CHMP4A	physical	14505570
CHM4B_HUMAN	CHMP4B	physical	14505570
VPS4A_HUMAN	VPS4A	physical	14505570
CHM4C_HUMAN	CHMP4C	physical	14505570
C2D1A_HUMAN	CC2D1A	physical	16730941
TP4AP_HUMAN	TRPC4AP	physical	16730941
PDC6I_HUMAN	PDCD6IP	physical	21988832
CHM1B_HUMAN	CHMP1B	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.