CHM4A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CHM4A_HUMAN
• UniProt AC: Q9BY43
• Protein Name: Charged multivesicular body protein 4a
• Gene Name: CHMP4A
• Organism: Homo sapiens (Human).
• Sequence Length: 222
• Subcellular Localization: Cytoplasmic vesicle membrane. Late endosome membrane ; Peripheral membrane protein . Membrane-associated. Localizes to large vesicle-like structures. Localizes to the midbody of dividing cells. Localized in two distinct rings on either side of the Fl
• Protein Description: Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. When overexpressed, membrane-assembled circular arrays of CHMP4A filaments can promote or stabilize negative curvature and outward budding. Via its interaction with PDCD6IP involved in HIV-1 p6- and p9-dependent virus release. CHMP4A/B/C are required for the exosomal release of SDCBP, CD63 and syndecan. [PubMed: 22660413]
• Protein Sequence: MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
45	Phosphorylation	EFLEQKIQQELQTAK HHHHHHHHHHHHHHH	37.42	20068231
45 (in isoform 2)	Phosphorylation	-	37.42	20068231
50	Phosphorylation	KIQQELQTAKKYGTK HHHHHHHHHHHHCCH	53.74	27470641
58	Ubiquitination	AKKYGTKNKRAALQA HHHHCCHHHHHHHHH	38.59	-
68	Ubiquitination	AALQALRRKKRFEQQ HHHHHHHHHHHHHHH	50.09	-
97	Phosphorylation	REAIENATTNAEVLR HHHHHHCCCCHHHHH	31.97	27470641
112	Phosphorylation	TMELAAQSMKKAYQD HHHHHHHHHHHHHHC	28.04	27470641
114	Acetylation	ELAAQSMKKAYQDMD HHHHHHHHHHHHCCC	39.23	25953088
157	Ubiquitination	MGFGDDVDEDELLEE CCCCCCCCHHHHHHH	65.70	-
193	Phosphorylation	EPSVKLPSVPSTHLP CCCCCCCCCCCCCCC	58.03	25849741
196	Phosphorylation	VKLPSVPSTHLPAGP CCCCCCCCCCCCCCC	26.72	25159151
197	Phosphorylation	KLPSVPSTHLPAGPA CCCCCCCCCCCCCCC	22.74	26657352
236	Phosphorylation	--------------------- ---------------------		-
239	Phosphorylation	------------------------ ------------------------		-
249	Ubiquitination	---------------------------------- ----------------------------------		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CHM4A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CHM4A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CHM4A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SYT17_HUMAN	SYT17	physical	16189514
PDC6I_HUMAN	PDCD6IP	physical	14505570
CHMP3_HUMAN	CHMP3	physical	14505570
VPS4A_HUMAN	VPS4A	physical	14505570
GAG_HV1H2	gag	physical	14505569
CHM4A_HUMAN	CHMP4A	physical	16730941
C2D1A_HUMAN	CC2D1A	physical	16730941
TTC19_HUMAN	TTC19	physical	16730941
CDK13_HUMAN	CDK13	physical	16730941
SYT17_HUMAN	SYT17	physical	16730941
STABP_HUMAN	STAMBP	physical	16730941
VPS4B_HUMAN	VPS4B	physical	22939629
EGFR_HUMAN	EGFR	physical	23477725
PURA2_HUMAN	ADSS	physical	22863883
CHRC1_HUMAN	CHRAC1	physical	22863883
EFHD2_HUMAN	EFHD2	physical	22863883
CH10_HUMAN	HSPE1	physical	22863883
IDHC_HUMAN	IDH1	physical	22863883
RANG_HUMAN	RANBP1	physical	22863883
RBBP7_HUMAN	RBBP7	physical	22863883
RCN1_HUMAN	RCN1	physical	22863883
TALDO_HUMAN	TALDO1	physical	22863883
SYT17_HUMAN	SYT17	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.