UniProt ID | CHRC1_HUMAN | |
---|---|---|
UniProt AC | Q9NRG0 | |
Protein Name | Chromatin accessibility complex protein 1 | |
Gene Name | CHRAC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 131 | |
Subcellular Localization | Nucleus . | |
Protein Description | Forms a complex with DNA polymerase epsilon subunit POLE3 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome remodeling activity of ISWI/SNF2H and ACF1.. | |
Protein Sequence | MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADVVVGKD ------CCCEEEECC | 20.50 | 22814378 | |
8 | Acetylation | MADVVVGKDKGGEQR CCCEEEECCCCCCEE | 44.66 | 23749302 | |
8 | Ubiquitination | MADVVVGKDKGGEQR CCCEEEECCCCCCEE | 44.66 | 33845483 | |
60 | Phosphorylation | VQCLATYSYRHGSGK HHHHHHCHHHCCCCC | 16.01 | 24719451 | |
67 | Acetylation | SYRHGSGKEKKVLTY HHHCCCCCEEEEEEH | 68.97 | 156597 | |
102 | 2-Hydroxyisobutyrylation | PKKILASKYLKMLKE CHHHHHHHHHHHHHH | 49.33 | - | |
102 | Acetylation | PKKILASKYLKMLKE CHHHHHHHHHHHHHH | 49.33 | 19608861 | |
102 | Ubiquitination | PKKILASKYLKMLKE CHHHHHHHHHHHHHH | 49.33 | 33845483 | |
105 | "N6,N6-dimethyllysine" | ILASKYLKMLKEEKR HHHHHHHHHHHHHHH | 38.81 | - | |
105 | Methylation | ILASKYLKMLKEEKR HHHHHHHHHHHHHHH | 38.81 | 23644510 | |
108 | "N6,N6-dimethyllysine" | SKYLKMLKEEKREED HHHHHHHHHHHHHHH | 61.40 | - | |
108 | Methylation | SKYLKMLKEEKREED HHHHHHHHHHHHHHH | 61.40 | 23644510 | |
124 | Phosphorylation | ENDNDNESDHDEADS CCCCCCCCCCCCCCC | 46.64 | 22167270 | |
131 | Phosphorylation | SDHDEADS------- CCCCCCCC------- | 49.52 | 22167270 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CHRC1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CHRC1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CHRC1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BAZ1A_HUMAN | BAZ1A | physical | 14759371 | |
SMCA5_HUMAN | SMARCA5 | physical | 14759371 | |
A4_HUMAN | APP | physical | 21832049 | |
SMCA5_HUMAN | SMARCA5 | physical | 22939629 | |
XPC_HUMAN | XPC | physical | 22939629 | |
RPC9_HUMAN | CRCP | physical | 22939629 | |
IN80C_HUMAN | INO80C | physical | 22939629 | |
PURA2_HUMAN | ADSS | physical | 22863883 | |
CUTA_HUMAN | CUTA | physical | 22863883 | |
AATC_HUMAN | GOT1 | physical | 22863883 | |
MTAP_HUMAN | MTAP | physical | 22863883 | |
NDKA_HUMAN | NME1 | physical | 22863883 | |
PTN11_HUMAN | PTPN11 | physical | 22863883 | |
RBBP7_HUMAN | RBBP7 | physical | 22863883 | |
TALDO_HUMAN | TALDO1 | physical | 22863883 | |
FAM9B_HUMAN | FAM9B | physical | 25416956 | |
DPOE3_HUMAN | POLE3 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-102, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-124, AND MASSSPECTROMETRY. |