LSM10_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LSM10_HUMAN
• UniProt AC: Q969L4
• Protein Name: U7 snRNA-associated Sm-like protein LSm10
• Gene Name: LSM10
• Organism: Homo sapiens (Human).
• Sequence Length: 123
• Subcellular Localization: Nucleus .
• Protein Description: Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner..
• Protein Sequence: MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
58	Phosphorylation	NIRLAKVTYTDRWGH CEEEEEEEEECCCCC	21.72	20363803
75	Phosphorylation	KLDDLFVTGRNVRYV EHHHEEECCCCEEEE	24.08	24719451
110	Ubiquitination	RVRNFGGKGQGRWEF HHHHCCCCCCCCCCC	48.73	27667366

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LSM10_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LSM10_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LSM10_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZN473_HUMAN	ZNF473	physical	11782445

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.