DEFM_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DEFM_HUMAN
• UniProt AC: Q9HBH1
• Protein Name: Peptide deformylase, mitochondrial
• Gene Name: PDF
• Organism: Homo sapiens (Human).
• Sequence Length: 243
• Subcellular Localization: Mitochondrion .
• Protein Description: Removes the formyl group from the N-terminal Met of newly synthesized proteins..
• Protein Sequence: MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
112	Phosphorylation	RRRCVGLSAPQLGVP HCCCCCCCCCCCCCC	31.79	21964256
227	Acetylation	QGCLFIDKMDSRTFT CCCEEEEECCCCCEE	39.53	25038526
240	Ubiquitination	FTNVYWMKVND---- EEEEEEEEECC----	24.60	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DEFM_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DEFM_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DEFM_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MYO5B_HUMAN	MYO5B	physical	27173435

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.