| UniProt ID | SNG1_HUMAN | |
|---|---|---|
| UniProt AC | O43759 | |
| Protein Name | Synaptogyrin-1 {ECO:0000305} | |
| Gene Name | SYNGR1 {ECO:0000312|HGNC:HGNC:11498} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 233 | |
| Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Multi-pass membrane protein . Melanosome . Identified by mass spectrometry in melanosome fractions from stage I to stage IV. |
|
| Protein Description | May play a role in regulated exocytosis. Modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in synaptic-like microvesicle formation and/or maturation (By similarity). Involved in the regulation of short-term and long-term synaptic plasticity (By similarity).. | |
| Protein Sequence | MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWAGQAVLAFQRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPTGPDPAGMGGTYQQPANTFDTEPQGYQSQGY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEGGAYGA -------CCCCCCCC | 11.02 | 19413330 | |
| 10 | Ubiquitination | GGAYGAGKAGGAFDP CCCCCCCCCCCCCCH | 43.24 | 23000965 | |
| 10 (in isoform 1) | Ubiquitination | - | 43.24 | 21890473 | |
| 10 (in isoform 2) | Ubiquitination | - | 43.24 | 21890473 | |
| 18 | Phosphorylation | AGGAFDPYTLVRQPH CCCCCCHHHHHCCHH | 17.98 | - | |
| 26 | Phosphorylation | TLVRQPHTILRVVSW HHHCCHHHHHHHHHH | 28.52 | - | |
| 176 (in isoform 2) | Phosphorylation | - | 14.82 | 28796482 | |
| 177 (in isoform 3) | Phosphorylation | - | 29.27 | 28796482 | |
| 181 (in isoform 2) | Phosphorylation | - | 6.53 | 28796482 | |
| 182 (in isoform 3) | Phosphorylation | - | 24.00 | 28796482 | |
| 182 (in isoform 2) | Phosphorylation | - | 24.00 | 28796482 | |
| 183 (in isoform 2) | Phosphorylation | - | 38.22 | 28796482 | |
| 183 (in isoform 3) | Phosphorylation | - | 38.22 | 28796482 | |
| 184 (in isoform 3) | Phosphorylation | - | 39.25 | 28796482 | |
| 188 (in isoform 2) | Phosphorylation | - | 19.84 | 28796482 | |
| 189 (in isoform 3) | Phosphorylation | - | 42.21 | 28796482 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNG1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNG1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNG1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FATE1_HUMAN | FATE1 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. | |
