UniProt ID | RPRM_HUMAN | |
---|---|---|
UniProt AC | Q9NS64 | |
Protein Name | Protein reprimo | |
Gene Name | RPRM | |
Organism | Homo sapiens (Human). | |
Sequence Length | 109 | |
Subcellular Localization |
Cytoplasm. Membrane Single-pass membrane protein . |
|
Protein Description | May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).. | |
Protein Sequence | MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | N-linked_Glycosylation | -MNPALGNQTDVAGL -CCCCCCCCCCHHHH | 42.29 | UniProtKB CARBOHYD | |
18 | N-linked_Glycosylation | VAGLFLANSSEALER HHHHEECCCHHHHHH | 48.49 | UniProtKB CARBOHYD | |
98 | Phosphorylation | LVKDRRPSKEVEAVV HHCCCCCCCCEEEEE | 39.37 | 24275748 | |
99 | Ubiquitination | VKDRRPSKEVEAVVV HCCCCCCCCEEEEEE | 69.34 | 32142685 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPRM_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPRM_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPRM_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CUL1_HUMAN | CUL1 | physical | 17353931 | |
FBW1B_HUMAN | FBXW11 | physical | 17353931 | |
CDK4_HUMAN | CDK4 | physical | 17353931 | |
TMM79_HUMAN | TMEM79 | physical | 25416956 | |
FATE1_HUMAN | FATE1 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...